Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | MO978_RS11215 | Genome accession | NZ_CP093959 |
| Coordinates | 2212465..2212749 (-) | Length | 94 a.a. |
| NCBI ID | WP_003129993.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain FAM 17919 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2210177..2244524 | 2212465..2212749 | within | 0 |
Gene organization within MGE regions
Location: 2210177..2244524
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MO978_RS11200 (MO978_11190) | - | 2210177..2210914 (-) | 738 | WP_058221575.1 | metal ABC transporter ATP-binding protein | - |
| MO978_RS11205 (MO978_11195) | - | 2211091..2211933 (-) | 843 | WP_003129990.1 | metal ABC transporter substrate-binding protein | - |
| MO978_RS11210 (MO978_11200) | - | 2211930..2212367 (-) | 438 | WP_003129992.1 | zinc-dependent MarR family transcriptional regulator | - |
| MO978_RS11215 (MO978_11205) | comGG | 2212465..2212749 (-) | 285 | WP_003129993.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| MO978_RS11220 (MO978_11210) | comGF | 2212788..2213234 (-) | 447 | WP_289421826.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MO978_RS11225 (MO978_11215) | comGE | 2213197..2213493 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| MO978_RS11230 (MO978_11220) | comGD | 2213465..2213896 (-) | 432 | WP_080585155.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MO978_RS11235 (MO978_11225) | comGC | 2213856..2214124 (-) | 269 | Protein_2186 | competence type IV pilus major pilin ComGC | - |
| MO978_RS11245 (MO978_11235) | - | 2214878..2215657 (-) | 780 | WP_373961894.1 | peptidoglycan amidohydrolase family protein | - |
| MO978_RS11250 (MO978_11240) | - | 2215657..2215956 (-) | 300 | WP_010905918.1 | phage holin | - |
| MO978_RS11255 (MO978_11245) | - | 2215969..2216319 (-) | 351 | WP_373961895.1 | hypothetical protein | - |
| MO978_RS11260 (MO978_11250) | - | 2216332..2216553 (-) | 222 | WP_031561031.1 | hypothetical protein | - |
| MO978_RS11265 (MO978_11255) | - | 2216572..2221002 (-) | 4431 | WP_373961896.1 | hypothetical protein | - |
| MO978_RS11270 (MO978_11260) | - | 2221002..2222564 (-) | 1563 | WP_373961897.1 | distal tail protein Dit | - |
| MO978_RS11275 (MO978_11265) | - | 2222565..2225177 (-) | 2613 | WP_373961898.1 | phage tail tape measure protein | - |
| MO978_RS11280 (MO978_11270) | - | 2225167..2225874 (-) | 708 | WP_031561043.1 | Gp15 family bacteriophage protein | - |
| MO978_RS11285 (MO978_11275) | - | 2225890..2226210 (-) | 321 | WP_373961899.1 | hypothetical protein | - |
| MO978_RS11290 (MO978_11280) | - | 2226192..2226455 (-) | 264 | WP_373961900.1 | hypothetical protein | - |
| MO978_RS11295 (MO978_11285) | - | 2226452..2226796 (-) | 345 | WP_014570557.1 | putative minor capsid protein | - |
| MO978_RS11300 (MO978_11290) | - | 2226786..2227187 (-) | 402 | WP_014570556.1 | hypothetical protein | - |
| MO978_RS11305 (MO978_11295) | - | 2227261..2227497 (-) | 237 | WP_014570555.1 | Ig-like domain-containing protein | - |
| MO978_RS11310 (MO978_11300) | - | 2227526..2228443 (-) | 918 | WP_031561049.1 | hypothetical protein | - |
| MO978_RS11315 (MO978_11305) | - | 2228458..2229519 (-) | 1062 | WP_031561051.1 | XkdF-like putative serine protease domain-containing protein | - |
| MO978_RS11320 (MO978_11310) | - | 2229535..2230365 (-) | 831 | WP_373961901.1 | phage minor head protein | - |
| MO978_RS11325 (MO978_11315) | - | 2230358..2231887 (-) | 1530 | WP_373961902.1 | phage portal protein | - |
| MO978_RS11330 (MO978_11320) | terL | 2231900..2233351 (-) | 1452 | WP_373961903.1 | phage terminase large subunit | - |
| MO978_RS11335 (MO978_11325) | - | 2233332..2233829 (-) | 498 | WP_014570801.1 | hypothetical protein | - |
| MO978_RS11340 (MO978_11330) | - | 2233858..2235015 (-) | 1158 | WP_373961904.1 | DNA modification methylase | - |
| MO978_RS11350 (MO978_11340) | - | 2235491..2235916 (-) | 426 | WP_373961905.1 | RinA family protein | - |
| MO978_RS11355 (MO978_11345) | - | 2235992..2236351 (-) | 360 | WP_129300455.1 | hypothetical protein | - |
| MO978_RS11360 (MO978_11350) | - | 2236476..2236676 (-) | 201 | WP_373961906.1 | DUF1660 domain-containing protein | - |
| MO978_RS11365 (MO978_11355) | - | 2236673..2236915 (-) | 243 | WP_014570545.1 | hypothetical protein | - |
| MO978_RS11370 (MO978_11360) | - | 2236962..2237207 (-) | 246 | WP_058221649.1 | hypothetical protein | - |
| MO978_RS11375 (MO978_11365) | - | 2237229..2237564 (-) | 336 | WP_373961907.1 | hypothetical protein | - |
| MO978_RS11380 (MO978_11370) | - | 2237568..2237987 (-) | 420 | WP_373961908.1 | dUTP diphosphatase | - |
| MO978_RS11385 (MO978_11375) | - | 2237984..2238181 (-) | 198 | WP_373961909.1 | hypothetical protein | - |
| MO978_RS11390 (MO978_11380) | - | 2238141..2238305 (-) | 165 | WP_373961910.1 | hypothetical protein | - |
| MO978_RS11395 (MO978_11385) | - | 2238302..2238919 (-) | 618 | WP_373961911.1 | hypothetical protein | - |
| MO978_RS11400 (MO978_11390) | - | 2239022..2239270 (-) | 249 | WP_014570815.1 | hypothetical protein | - |
| MO978_RS11405 | - | 2239284..2239406 (-) | 123 | WP_023164646.1 | hypothetical protein | - |
| MO978_RS11410 (MO978_11395) | - | 2239403..2239585 (-) | 183 | WP_023349176.1 | hypothetical protein | - |
| MO978_RS11415 (MO978_11400) | - | 2239649..2239858 (-) | 210 | WP_023349177.1 | helix-turn-helix transcriptional regulator | - |
| MO978_RS11420 (MO978_11405) | - | 2240049..2240471 (+) | 423 | WP_023349178.1 | helix-turn-helix transcriptional regulator | - |
| MO978_RS11425 (MO978_11410) | - | 2240482..2241066 (+) | 585 | WP_023349179.1 | hypothetical protein | - |
| MO978_RS11430 (MO978_11415) | - | 2241120..2241782 (+) | 663 | WP_023349180.1 | SHOCT domain-containing protein | - |
| MO978_RS11435 (MO978_11420) | - | 2241897..2243354 (+) | 1458 | WP_023349181.1 | recombinase family protein | - |
| MO978_RS11440 (MO978_11425) | - | 2243351..2243491 (-) | 141 | WP_023349182.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=665955 MO978_RS11215 WP_003129993.1 2212465..2212749(-) (comGG) [Lactococcus lactis strain FAM 17919]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK
Nucleotide
Download Length: 285 bp
>NTDB_id=665955 MO978_RS11215 WP_003129993.1 2212465..2212749(-) (comGG) [Lactococcus lactis strain FAM 17919]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAACAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAACAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
58.511 |
100 |
0.585 |