Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   MOW04_RS13070 Genome accession   NZ_CP093546
Coordinates   2529728..2530138 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus sp. K1     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2525096..2551415 2529728..2530138 within 0


Gene organization within MGE regions


Location: 2525096..2551415
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MOW04_RS13045 - 2525263..2525994 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  MOW04_RS13050 cwlH 2526245..2526996 (-) 752 Protein_2523 N-acetylmuramoyl-L-alanine amidase CwlH -
  MOW04_RS13055 - 2527183..2527809 (+) 627 WP_015251671.1 TVP38/TMEM64 family protein -
  MOW04_RS13060 gnd 2527828..2528721 (-) 894 WP_015714298.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  MOW04_RS13065 - 2528973..2529695 (+) 723 WP_046381199.1 hypothetical protein -
  MOW04_RS13070 nucA/comI 2529728..2530138 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  MOW04_RS13075 - 2530334..2530678 (+) 345 Protein_2528 sigma-70 family RNA polymerase sigma factor -
  MOW04_RS13080 - 2530824..2531294 (+) 471 WP_033884465.1 MarR family transcriptional regulator -
  MOW04_RS13085 - 2531445..2532857 (+) 1413 WP_163130609.1 MDR family MFS transporter -
  MOW04_RS13090 spoIVCA 2533046..2534506 (-) 1461 WP_250620787.1 site-specific DNA recombinase SpoIVCA -
  MOW04_RS13095 - 2534464..2534642 (-) 179 Protein_2532 hypothetical protein -
  MOW04_RS13100 - 2534887..2535792 (-) 906 WP_163130820.1 LysR family transcriptional regulator -
  MOW04_RS13105 - 2535923..2537182 (+) 1260 WP_163130603.1 APC family permease -
  MOW04_RS13110 rapE 2537631..2538759 (+) 1129 Protein_2535 response regulator aspartate phosphatase RapE -
  MOW04_RS13115 phrE 2538749..2538883 (+) 135 WP_014114495.1 phosphatase RapE inhibitor PhrE -
  MOW04_RS13120 - 2539517..2540239 (-) 723 WP_119899593.1 NAD(P)-binding domain-containing protein -
  MOW04_RS13125 - 2540465..2540824 (+) 360 WP_049635841.1 winged helix-turn-helix transcriptional regulator -
  MOW04_RS13130 nfsA 2541304..2542044 (+) 741 WP_119899595.1 oxygen-insensitive NADPH nitroreductase -
  MOW04_RS13135 - 2542522..2543649 (-) 1128 WP_038429342.1 Rap family tetratricopeptide repeat protein -
  MOW04_RS13140 - 2543835..2545727 (+) 1893 WP_163130600.1 T7SS effector LXG polymorphic toxin -
  MOW04_RS13145 cdiI 2545749..2546108 (+) 360 WP_040082462.1 ribonuclease toxin immunity protein CdiI -
  MOW04_RS13150 - 2546160..2546495 (+) 336 WP_069322770.1 tRNA-Val4 -
  MOW04_RS13155 - 2546556..2546996 (+) 441 WP_069322771.1 SMI1/KNR4 family protein -
  MOW04_RS13160 - 2547095..2547445 (+) 351 WP_250620785.1 SMI1/KNR4 family protein -
  MOW04_RS13165 - 2547743..2548288 (-) 546 WP_069322772.1 SMI1/KNR4 family protein -
  MOW04_RS13170 - 2548308..2549300 (-) 993 WP_224912955.1 HNH endonuclease signature motif containing protein -
  MOW04_RS13175 - 2549433..2550251 (-) 819 WP_163130597.1 N-acetylmuramoyl-L-alanine amidase -
  MOW04_RS13180 - 2550296..2550436 (-) 141 Protein_2549 phage holin family protein -
  MOW04_RS13185 - 2550463..2550648 (-) 186 Protein_2550 phage terminase large subunit -
  MOW04_RS13190 terS 2550645..2551415 (-) 771 Protein_2551 phage terminase small subunit -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=665159 MOW04_RS13070 WP_009967785.1 2529728..2530138(-) (nucA/comI) [Bacillus sp. K1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=665159 MOW04_RS13070 WP_009967785.1 2529728..2530138(-) (nucA/comI) [Bacillus sp. K1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGGGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGTACCAGAGTGCTGTTTA
TTGTGCAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529