Detailed information    

insolico Bioinformatically predicted

Overview


Name   dinR/lexA   Type   Regulator
Locus tag   OG762_RS37105 Genome accession   NZ_CP108632
Coordinates   8124048..8124272 (+) Length   74 a.a.
NCBI ID   WP_405888914.1    Uniprot ID   -
Organism   Streptomyces sp. NBC_01136     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context


Location: 8119048..8129272
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OG762_RS37075 (OG762_37165) - 8119077..8119199 (+) 123 WP_405888908.1 hypothetical protein -
  OG762_RS37080 (OG762_37170) - 8119196..8119504 (+) 309 WP_405888909.1 hypothetical protein -
  OG762_RS37085 (OG762_37175) - 8119858..8121513 (+) 1656 WP_405888910.1 TROVE domain-containing protein -
  OG762_RS37090 (OG762_37180) - 8122001..8122279 (+) 279 WP_405888911.1 hypothetical protein -
  OG762_RS37095 (OG762_37185) - 8122306..8122779 (+) 474 WP_405888912.1 hypothetical protein -
  OG762_RS37100 (OG762_37190) - 8122776..8123804 (+) 1029 WP_405888913.1 tyrosine-type recombinase/integrase -
  OG762_RS37105 (OG762_37195) dinR/lexA 8124048..8124272 (+) 225 WP_405888914.1 LexA family protein Regulator
  OG762_RS37110 (OG762_37200) - 8124269..8124484 (+) 216 WP_405888915.1 hypothetical protein -
  OG762_RS37115 (OG762_37205) - 8124634..8124834 (-) 201 WP_405888916.1 hypothetical protein -
  OG762_RS37120 (OG762_37210) - 8124883..8125386 (+) 504 WP_405888917.1 ImmA/IrrE family metallo-endopeptidase -
  OG762_RS37125 (OG762_37215) - 8125389..8125583 (-) 195 WP_405888918.1 hypothetical protein -
  OG762_RS37130 (OG762_37220) - 8125617..8125880 (-) 264 WP_405883703.1 GntR family transcriptional regulator -
  OG762_RS37135 (OG762_37225) - 8126477..8126707 (-) 231 WP_405883704.1 helix-turn-helix domain-containing protein -
  OG762_RS37140 (OG762_37230) uraD 8127670..8128215 (+) 546 WP_405883705.1 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase -
  OG762_RS37145 (OG762_37235) uraH 8128212..8128619 (+) 408 WP_405883706.1 hydroxyisourate hydrolase -

Sequence


Protein


Download         Length: 74 a.a.        Molecular weight: 8488.73 Da        Isoelectric Point: 10.4080

>NTDB_id=664144 OG762_RS37105 WP_405888914.1 8124048..8124272(+) (dinR/lexA) [Streptomyces sp. NBC_01136]
MAHYKVPHLTDTQERILRCIRDTIADRGEAPTVQEIGERVGMRSRASVHYQLGELESKHAIVREPGRRRGIRLA

Nucleotide


Download         Length: 225 bp        

>NTDB_id=664144 OG762_RS37105 WP_405888914.1 8124048..8124272(+) (dinR/lexA) [Streptomyces sp. NBC_01136]
ATGGCCCACTACAAGGTCCCCCACCTCACCGACACCCAGGAACGCATCCTCCGCTGCATCCGCGACACCATCGCCGACCG
CGGGGAGGCACCGACCGTGCAGGAGATCGGCGAGCGGGTCGGCATGCGCAGCCGCGCCTCCGTCCACTACCAGCTGGGCG
AGCTGGAGTCGAAGCACGCGATCGTTCGAGAGCCGGGCCGGCGCCGCGGGATCAGGCTCGCATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

41.538

87.838

0.365