Detailed information    

experimental Experimentally validated

Overview

Name   dinR/lexA   Type   Regulator
Locus tag   BSU_17850 Genome accession   NC_000964
Coordinates   1917639..1918256 (-) Length   205 a.a.
NCBI ID   NP_389668.1    Uniprot ID   P31080
Organism   Bacillus subtilis subsp. subtilis str. 168     
Function   repressor of recA; repressor of dinR   
Homologous recombination

Function

A dinR insertion mutation caused a high, constitutive expression of both dinR and recA. Gel-retardation assays demonstrated a direct interaction between the dinR gene product and the recA and dinR promoter regions.


Genomic Context

Location: 1912639..1923256
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BSU_17800 (BSU17800) yndJ 1912953..1914593 (+) 1641 NP_389663.1 putative integral inner membrane protein -
  BSU_17810 (BSU17810) yndK 1914630..1914995 (+) 366 NP_389664.1 putative phage/plasmid replication protein -
  BSU_17820 (BSU17820) pghL 1915221..1915979 (+) 759 NP_389665.1 phage gamma-polyglutamate hydrolase -
  BSU_17830 (BSU17830) yndM 1916006..1916545 (-) 540 NP_389666.1 putative integral inner membrane protein -
  BSU_17840 (BSU17840) fosB 1916663..1917097 (+) 435 NP_389667.1 magnesium-dependent bacillithiol-transferase -
  BSU_17845 (BSU17845) yzzP 1916955..1917302 (+) 348 YP_009513960.1 hypothetical protein -
  BSU_17850 (BSU17850) dinR/lexA 1917639..1918256 (-) 618 NP_389668.1 transcriptional repressor of the SOS regulon Regulator
  BSU_17860 (BSU17860) dinK 1918406..1918723 (+) 318 NP_389669.1 cell division inhibitor -
  BSU_17870 (BSU17870) dinL 1918742..1919395 (+) 654 NP_389670.1 putative site-specific recombinase, resolvase -
  BSU_17880 (BSU17880) ynzC 1919459..1919692 (+) 234 NP_389671.1 hypothetical protein -
  BSU_17890 (BSU17890) recP/tkt 1919861..1921864 (+) 2004 NP_389672.1 transketolase Machinery gene
  BSU_17900 (BSU17900) pcfA 1922017..1922463 (+) 447 NP_389673.1 factor controlling DNA replication -
  BSU_17910 (BSU17910) yneF 1922549..1922767 (+) 219 NP_389674.1 putative acyltransferase -
  BSU_17920 (BSU17920) spo0D 1922841..1923014 (-) 174 NP_389675.1 Spo0A-P phosphatase -

Regulatory network

Positive effect      
Negative effect
Regulator Target Regulation
  dinR/lexA recA negative effect
  recX recA negative effect
  dinR/lexA dinR/lexA negative effect

Sequence

Protein


Download         Length: 205 a.a.        Molecular weight: 22849.36 Da        Isoelectric Point: 5.1450

>NTDB_id=646 BSU_17850 NP_389668.1 1917639..1918256(-) (dinR/lexA) [Bacillus subtilis subsp. subtilis str. 168]
MTKLSKRQLDILRFIKAEVKSKGYPPSVREIGEAVGLASSSTVHGHLARLETKGLIRRDPTKPRAIEILDEEVDIPQSQV
VNVPVIGKVTAGSPITAVENIEEYFPLPDRMVPPDEHVFMLEIMGDSMIDAGILDKDYVIVKQQNTANNGEIVVAMTEDD
EATVKRFYKEDTHIRLQPENPTMEPIILQNVSILGKVIGVFRTVH

Nucleotide


Download         Length: 618 bp        

>NTDB_id=646 BSU_17850 NP_389668.1 1917639..1918256(-) (dinR/lexA) [Bacillus subtilis subsp. subtilis str. 168]
ATGACGAAGCTATCAAAAAGGCAACTTGATATCCTCCGTTTTATTAAAGCAGAGGTTAAATCAAAAGGATATCCGCCTTC
CGTGAGAGAGATCGGAGAGGCTGTCGGGCTTGCGTCCAGTTCTACTGTCCACGGCCATTTGGCCCGTTTGGAAACAAAAG
GGCTGATCAGACGAGATCCGACAAAACCAAGAGCAATAGAAATTCTTGATGAAGAAGTAGACATTCCGCAAAGCCAGGTC
GTTAATGTACCGGTCATCGGGAAAGTCACGGCGGGATCTCCTATTACAGCAGTAGAAAATATTGAAGAATATTTTCCGCT
CCCTGACCGCATGGTTCCTCCAGACGAGCATGTATTTATGCTGGAGATTATGGGAGACAGTATGATAGATGCTGGTATTC
TCGATAAGGACTATGTCATCGTTAAACAGCAAAACACAGCGAACAATGGGGAAATTGTAGTTGCGATGACAGAAGATGAT
GAAGCAACTGTAAAACGATTCTATAAAGAGGATACCCACATTCGCTTGCAGCCTGAGAACCCAACGATGGAACCTATCAT
TTTGCAGAATGTCAGCATTCTAGGGAAAGTGATTGGCGTGTTCAGAACCGTCCATTAA

Domains

Predicted by InterProScan.

LexA DNA binding domain (LexA_DNA_bind)

(1-65)

Peptidase S24-like (Peptidase_S24)

(84-198)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P31080

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value

References

[1] K W Winterling et al. (1998) The Bacillus subtilis DinR binding site: redefinition of the consensus sequence. Journal of Bacteriology 180(8):2201-11. [PMID: 9555905]
[2] K W Winterling et al. (1997) Characterization of DinR, the Bacillus subtilis SOS repressor. Journal of Bacteriology 179(5):1698-703. [PMID: 9045831]
[3] B J Haijema et al. (1996) Regulated expression of the dinR and recA genes during competence development and SOS induction in Bacillus subtilis. Molecular Microbiology 22(1):75-85. [PMID: 8899710]
[4] A Raymond-Denise et al. (1992) Expression of the Bacillus subtilis dinR and recA genes after DNA damage and during competence. Journal of Bacteriology 174(10):3171-6. [PMID: 1577687]
[5] A Raymond-Denise et al. (1991) Identification of dinR, a DNA damage-inducible regulator gene of Bacillus subtilis. Journal of Bacteriology 173(22):7084-91. [PMID: 1657879]