Detailed information NTG0663832

Bioinformatically predicted

Overview

• Name: pilE
• Type: Machinery gene
• Locus tag: MNR01_RS14755
• Genome accession: NZ_CP093341
• Coordinates: 3284365..3284784 (-)
• Length: 139 a.a.
• NCBI ID: WP_241918513.1
• Uniprot ID: -
• Organism: Lysobacter sp. S4-A87
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	3279747..3297388	3284365..3284784	within	0

Gene organization within MGE regions

Location: 3279747..3297388

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MNR01_RS14730 (MNR01_14730)	-	3279747..3280604 (+)	858	WP_241918508.1	glycosyltransferase family 2 protein	-
MNR01_RS14735 (MNR01_14735)	-	3280604..3281332 (+)	729	WP_241918509.1	class I SAM-dependent methyltransferase	-
MNR01_RS14740 (MNR01_14740)	-	3281272..3282156 (+)	885	WP_241918510.1	class I SAM-dependent methyltransferase	-
MNR01_RS14745 (MNR01_14745)	-	3282171..3283124 (+)	954	WP_241918511.1	hypothetical protein	-
MNR01_RS14750 (MNR01_14750)	-	3283152..3284297 (-)	1146	WP_241918512.1	glycosyltransferase family 4 protein	-
MNR01_RS14755 (MNR01_14755)	pilE	3284365..3284784 (-)	420	WP_241918513.1	pilin	Machinery gene
MNR01_RS14760 (MNR01_14760)	-	3284971..3286491 (-)	1521	WP_241918514.1	hypothetical protein	-
MNR01_RS14765 (MNR01_14765)	-	3286973..3288919 (-)	1947	WP_241918515.1	hypothetical protein	-
MNR01_RS14770 (MNR01_14770)	pilE	3288993..3289421 (-)	429	WP_241918516.1	pilin	Machinery gene
MNR01_RS14775 (MNR01_14775)	pilR	3289836..3291284 (-)	1449	WP_241918517.1	sigma-54 dependent transcriptional regulator	Regulator
MNR01_RS14780 (MNR01_14780)	-	3291416..3293038 (-)	1623	WP_241918518.1	ATP-binding protein	-
MNR01_RS14785 (MNR01_14785)	sucC	3293271..3294437 (+)	1167	WP_241918519.1	ADP-forming succinate--CoA ligase subunit beta	-
MNR01_RS14790 (MNR01_14790)	sucD	3294450..3295325 (+)	876	WP_241918520.1	succinate--CoA ligase subunit alpha	-
MNR01_RS14795 (MNR01_14795)	-	3295451..3297388 (+)	1938	WP_256451847.1	acyltransferase family protein	-

Sequence

Protein

• Length: 139 a.a.
• Molecular weight: 14682.70 Da
• Isoelectric Point: 5.7851

>NTDB_id=663832 MNR01_RS14755 WP_241918513.1 3284365..3284784(-) (pilE) [Lysobacter sp. S4-A87]
MYSDRGFTLIELMIVVAIIAILAAIALPAYQDYVTRAQVAEGFGLATGAKLAVALYYGDRGEYPADNAQAGMAAPASISG
RHVQSVTVDNTGQIEVRFSSNANAKIQSAVLTLQAQNNDGSLSWRCGGLEAKYLPAPCR

Nucleotide

• Length: 420 bp

>NTDB_id=663832 MNR01_RS14755 WP_241918513.1 3284365..3284784(-) (pilE) [Lysobacter sp. S4-A87]
ATGTACTCGGATCGTGGTTTTACGCTGATCGAACTCATGATCGTGGTTGCGATCATCGCTATCCTCGCTGCAATCGCCCT
GCCGGCATACCAGGACTACGTGACGCGCGCCCAGGTCGCGGAAGGCTTCGGCCTTGCCACTGGCGCCAAGCTCGCCGTCG
CTCTCTACTACGGCGACAGAGGGGAATATCCGGCTGACAACGCGCAAGCAGGCATGGCGGCCCCGGCCTCGATCAGCGGA
CGCCACGTGCAGTCCGTGACCGTCGACAACACCGGGCAGATCGAAGTGCGCTTCAGCAGCAATGCCAACGCCAAGATCCA
ATCGGCAGTCCTCACGCTCCAGGCACAGAACAACGATGGCAGCCTGAGCTGGCGGTGCGGCGGACTGGAGGCAAAGTACC
TTCCCGCCCCCTGCCGCTAG

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (35-139)

• Prokaryotic N-terminal methylation motif (N_methyl) (3-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilE	Neisseria gonorrhoeae strain FA1090	44.444	100	0.489
pilE	Neisseria gonorrhoeae MS11	42.857	100	0.475
pilA2	Legionella pneumophila strain ERS1305867	48.175	98.561	0.475
pilA2	Legionella pneumophila str. Paris	47.445	98.561	0.468
pilA/pilA1	Eikenella corrodens VA1	42	100	0.453
pilA	Ralstonia pseudosolanacearum GMI1000	36.97	100	0.439
comP	Acinetobacter baylyi ADP1	37.013	100	0.41
pilA/pilAI	Pseudomonas stutzeri DSM 10701	37.41	100	0.374
pilA	Acinetobacter baumannii strain A118	35.417	100	0.367
pilA	Haemophilus influenzae 86-028NP	37.5	97.842	0.367
pilA	Pseudomonas aeruginosa PAK	34	100	0.367