Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MNY35_RS19370 Genome accession   NZ_CP093298
Coordinates   3956107..3956280 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain MN-13     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3951107..3961280
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNY35_RS19320 (MNY35_19285) comGD 3951227..3951664 (+) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  MNY35_RS19325 (MNY35_19290) comGE 3951648..3951962 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MNY35_RS19330 (MNY35_19295) comGF 3951871..3952371 (+) 501 WP_257738552.1 competence type IV pilus minor pilin ComGF -
  MNY35_RS19335 (MNY35_19300) comGG 3952372..3952749 (+) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  MNY35_RS19340 (MNY35_19305) - 3952806..3952985 (+) 180 WP_003153093.1 YqzE family protein -
  MNY35_RS19345 (MNY35_19310) - 3953025..3953354 (-) 330 WP_039254490.1 DUF3889 domain-containing protein -
  MNY35_RS19350 (MNY35_19315) tapA 3953613..3954284 (+) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  MNY35_RS19355 (MNY35_19320) - 3954256..3954840 (+) 585 WP_015240205.1 signal peptidase I -
  MNY35_RS19360 (MNY35_19325) - 3954905..3955690 (+) 786 WP_007408329.1 TasA family protein -
  MNY35_RS19365 (MNY35_19330) sinR 3955738..3956073 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MNY35_RS19370 (MNY35_19335) sinI 3956107..3956280 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MNY35_RS19375 (MNY35_19340) - 3956457..3957251 (-) 795 WP_007408330.1 YqhG family protein -
  MNY35_RS19380 (MNY35_19345) - 3957273..3958943 (-) 1671 WP_031378948.1 SNF2-related protein -
  MNY35_RS19385 (MNY35_19350) gcvT 3959367..3960467 (+) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=663221 MNY35_RS19370 WP_003153105.1 3956107..3956280(-) (sinI) [Bacillus amyloliquefaciens strain MN-13]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=663221 MNY35_RS19370 WP_003153105.1 3956107..3956280(-) (sinI) [Bacillus amyloliquefaciens strain MN-13]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702