Detailed information    

insolico Bioinformatically predicted

Overview


Name   abrB   Type   Regulator
Locus tag   MN092_RS20015 Genome accession   NZ_CP093290
Coordinates   3861562..3861846 (-) Length   94 a.a.
NCBI ID   WP_003185421.1    Uniprot ID   A0A1Y0XQV9
Organism   Bacillus licheniformis strain DSM 13     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 3813244..3866717 3861562..3861846 within 0


Gene organization within MGE regions


Location: 3813244..3866717
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MN092_RS19720 (MN092_19720) - 3813244..3813834 (+) 591 WP_003185308.1 hypothetical protein -
  MN092_RS19725 (MN092_19725) - 3813936..3814310 (+) 375 Protein_3857 YolD-like family protein -
  MN092_RS19730 (MN092_19730) - 3814718..3815428 (-) 711 WP_003185310.1 DUF421 domain-containing protein -
  MN092_RS19735 (MN092_19735) - 3815636..3816487 (+) 852 WP_035334177.1 ferritin family protein -
  MN092_RS19740 (MN092_19740) - 3816643..3817236 (+) 594 WP_003185315.1 cupin domain-containing protein -
  MN092_RS19745 (MN092_19745) - 3817357..3818310 (-) 954 WP_061565932.1 glycoside hydrolase family 25 protein -
  MN092_RS19750 (MN092_19750) - 3818358..3818621 (-) 264 WP_003185319.1 phage holin -
  MN092_RS19755 (MN092_19755) - 3818637..3818906 (-) 270 WP_003185322.1 hemolysin XhlA family protein -
  MN092_RS19760 (MN092_19760) - 3818969..3819154 (-) 186 WP_003185324.1 XkdX family protein -
  MN092_RS19765 (MN092_19765) - 3819151..3819474 (-) 324 WP_003185326.1 bZIP transcription factor -
  MN092_RS19770 (MN092_19770) - 3819487..3820824 (-) 1338 WP_003185328.1 BppU family phage baseplate upper protein -
  MN092_RS19775 (MN092_19775) - 3820845..3822890 (-) 2046 WP_035334112.1 hypothetical protein -
  MN092_RS19780 (MN092_19780) - 3822927..3824639 (-) 1713 WP_003185331.1 phage tail protein -
  MN092_RS19785 (MN092_19785) - 3824652..3825488 (-) 837 WP_003185333.1 phage tail family protein -
  MN092_RS19790 (MN092_19790) - 3825488..3829960 (-) 4473 Protein_3870 phage tail tape measure protein -
  MN092_RS19795 (MN092_19795) gpG 3830169..3830531 (-) 363 WP_003185339.1 phage tail assembly chaperone G -
  MN092_RS19800 (MN092_19800) - 3830585..3831202 (-) 618 WP_003185341.1 major tail protein -
  MN092_RS19805 (MN092_19805) - 3831217..3831600 (-) 384 WP_003185344.1 hypothetical protein -
  MN092_RS19810 (MN092_19810) - 3831597..3831995 (-) 399 WP_003185346.1 HK97-gp10 family putative phage morphogenesis protein -
  MN092_RS19815 (MN092_19815) - 3831995..3832303 (-) 309 WP_003185349.1 phage head closure protein -
  MN092_RS19820 (MN092_19820) - 3832293..3832595 (-) 303 WP_003185351.1 head-tail connector protein -
  MN092_RS19825 (MN092_19825) - 3832616..3833041 (-) 426 WP_003185353.1 collagen-like protein -
  MN092_RS19830 (MN092_19830) - 3833065..3834348 (-) 1284 WP_048350601.1 phage major capsid protein -
  MN092_RS19835 (MN092_19835) - 3834387..3835118 (-) 732 WP_061565933.1 head maturation protease, ClpP-related -
  MN092_RS19840 (MN092_19840) - 3835063..3836373 (-) 1311 WP_003185359.1 phage portal protein -
  MN092_RS19845 (MN092_19845) - 3836374..3836565 (-) 192 WP_003185361.1 DUF1056 family protein -
  MN092_RS19850 (MN092_19850) - 3836577..3838286 (-) 1710 WP_003185362.1 terminase large subunit -
  MN092_RS19855 (MN092_19855) - 3838283..3838798 (-) 516 WP_003185364.1 phage terminase small subunit P27 family -
  MN092_RS19860 (MN092_19860) - 3839028..3839402 (-) 375 WP_061565934.1 HNH endonuclease -
  MN092_RS19865 (MN092_19865) - 3839808..3841052 (-) 1245 WP_061565936.1 ComF family protein -
  MN092_RS19870 (MN092_19870) - 3841027..3842259 (-) 1233 WP_061565937.1 DNA-processing protein DprA -
  MN092_RS19875 (MN092_19875) cotD 3842577..3842801 (-) 225 WP_003185368.1 spore coat protein CotD -
  MN092_RS19880 (MN092_19880) - 3843551..3843931 (-) 381 WP_009330080.1 ArpU family phage packaging/lysis transcriptional regulator -
  MN092_RS19885 (MN092_19885) - 3844058..3844330 (-) 273 WP_009329245.1 DUF5052 family protein -
  MN092_RS19890 (MN092_19890) - 3844327..3844722 (-) 396 WP_009329247.1 YopX family protein -
  MN092_RS19895 (MN092_19895) - 3844738..3845253 (-) 516 WP_009329249.1 putative metallopeptidase -
  MN092_RS19900 (MN092_19900) fbpA 3845257..3845427 (-) 171 WP_017695850.1 Fur-regulated basic protein FbpA -
  MN092_RS19905 (MN092_19905) - 3845424..3845963 (-) 540 WP_020450341.1 ERCC4 domain-containing protein -
  MN092_RS19910 (MN092_19910) - 3845960..3846397 (-) 438 WP_061565938.1 hypothetical protein -
  MN092_RS19915 (MN092_19915) - 3846639..3849065 (-) 2427 WP_061565939.1 phage/plasmid primase, P4 family -
  MN092_RS19920 (MN092_19920) - 3849126..3849563 (-) 438 WP_061565940.1 DUF669 domain-containing protein -
  MN092_RS19925 (MN092_19925) - 3849563..3850495 (-) 933 WP_061565941.1 AAA family ATPase -
  MN092_RS19930 (MN092_19930) - 3850499..3851056 (-) 558 WP_061565942.1 host-nuclease inhibitor Gam family protein -
  MN092_RS19935 (MN092_19935) - 3851149..3851391 (-) 243 WP_011198322.1 hypothetical protein -
  MN092_RS19940 (MN092_19940) - 3851479..3851745 (-) 267 WP_061565943.1 YqaH family protein -
  MN092_RS19945 (MN092_19945) - 3851805..3852185 (+) 381 WP_003185396.1 DUF2513 domain-containing protein -
  MN092_RS19950 (MN092_19950) - 3852177..3852347 (-) 171 WP_003185398.1 hypothetical protein -
  MN092_RS19955 (MN092_19955) - 3852691..3853245 (-) 555 WP_003185401.1 hypothetical protein -
  MN092_RS19960 (MN092_19960) - 3853303..3853491 (-) 189 WP_016886536.1 hypothetical protein -
  MN092_RS19965 (MN092_19965) - 3853623..3853811 (-) 189 WP_003185403.1 helix-turn-helix transcriptional regulator -
  MN092_RS19970 (MN092_19970) - 3853808..3854602 (-) 795 WP_003185404.1 ORF6N domain-containing protein -
  MN092_RS19975 (MN092_19975) - 3854627..3854890 (-) 264 WP_227592746.1 helix-turn-helix domain-containing protein -
  MN092_RS19980 (MN092_19980) - 3855017..3855655 (+) 639 WP_003185408.1 LexA family protein -
  MN092_RS19985 (MN092_19985) - 3855726..3856820 (+) 1095 WP_003185410.1 tyrosine-type recombinase/integrase -
  MN092_RS19995 (MN092_19995) smpB 3857372..3857845 (-) 474 WP_009329604.1 SsrA-binding protein SmpB -
  MN092_RS20000 (MN092_20000) rnr 3857957..3860260 (-) 2304 WP_003185414.1 ribonuclease R -
  MN092_RS20005 (MN092_20005) - 3860274..3861020 (-) 747 WP_003185416.1 alpha/beta hydrolase -
  MN092_RS20010 (MN092_20010) secG 3861161..3861391 (-) 231 WP_003185418.1 preprotein translocase subunit SecG -
  MN092_RS20015 (MN092_20015) abrB 3861562..3861846 (-) 285 WP_003185421.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  MN092_RS20020 (MN092_20020) - 3861875..3862108 (-) 234 WP_085959538.1 helix-turn-helix domain-containing protein -
  MN092_RS20025 (MN092_20025) - 3862261..3862662 (+) 402 WP_009329609.1 transcriptional regulator -
  MN092_RS20030 (MN092_20030) - 3862832..3863230 (+) 399 WP_009329610.1 helix-turn-helix domain-containing protein -
  MN092_RS20035 (MN092_20035) - 3863278..3863955 (-) 678 WP_003185432.1 ABC transporter permease -
  MN092_RS20040 (MN092_20040) opuCC 3863972..3864889 (-) 918 WP_009329611.1 osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC -
  MN092_RS20045 (MN092_20045) - 3864903..3865556 (-) 654 WP_009329612.1 ABC transporter permease -
  MN092_RS20050 (MN092_20050) - 3865578..3866717 (-) 1140 WP_003185439.1 betaine/proline/choline family ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10486.36 Da        Isoelectric Point: 7.9620

>NTDB_id=663088 MN092_RS20015 WP_003185421.1 3861562..3861846(-) (abrB) [Bacillus licheniformis strain DSM 13]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=663088 MN092_RS20015 WP_003185421.1 3861562..3861846(-) (abrB) [Bacillus licheniformis strain DSM 13]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1Y0XQV9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

96.809

0.543