Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | MN092_RS20015 | Genome accession | NZ_CP093290 |
| Coordinates | 3861562..3861846 (-) | Length | 94 a.a. |
| NCBI ID | WP_003185421.1 | Uniprot ID | A0A1Y0XQV9 |
| Organism | Bacillus licheniformis strain DSM 13 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3813244..3866717 | 3861562..3861846 | within | 0 |
Gene organization within MGE regions
Location: 3813244..3866717
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MN092_RS19720 (MN092_19720) | - | 3813244..3813834 (+) | 591 | WP_003185308.1 | hypothetical protein | - |
| MN092_RS19725 (MN092_19725) | - | 3813936..3814310 (+) | 375 | Protein_3857 | YolD-like family protein | - |
| MN092_RS19730 (MN092_19730) | - | 3814718..3815428 (-) | 711 | WP_003185310.1 | DUF421 domain-containing protein | - |
| MN092_RS19735 (MN092_19735) | - | 3815636..3816487 (+) | 852 | WP_035334177.1 | ferritin family protein | - |
| MN092_RS19740 (MN092_19740) | - | 3816643..3817236 (+) | 594 | WP_003185315.1 | cupin domain-containing protein | - |
| MN092_RS19745 (MN092_19745) | - | 3817357..3818310 (-) | 954 | WP_061565932.1 | glycoside hydrolase family 25 protein | - |
| MN092_RS19750 (MN092_19750) | - | 3818358..3818621 (-) | 264 | WP_003185319.1 | phage holin | - |
| MN092_RS19755 (MN092_19755) | - | 3818637..3818906 (-) | 270 | WP_003185322.1 | hemolysin XhlA family protein | - |
| MN092_RS19760 (MN092_19760) | - | 3818969..3819154 (-) | 186 | WP_003185324.1 | XkdX family protein | - |
| MN092_RS19765 (MN092_19765) | - | 3819151..3819474 (-) | 324 | WP_003185326.1 | bZIP transcription factor | - |
| MN092_RS19770 (MN092_19770) | - | 3819487..3820824 (-) | 1338 | WP_003185328.1 | BppU family phage baseplate upper protein | - |
| MN092_RS19775 (MN092_19775) | - | 3820845..3822890 (-) | 2046 | WP_035334112.1 | hypothetical protein | - |
| MN092_RS19780 (MN092_19780) | - | 3822927..3824639 (-) | 1713 | WP_003185331.1 | phage tail protein | - |
| MN092_RS19785 (MN092_19785) | - | 3824652..3825488 (-) | 837 | WP_003185333.1 | phage tail family protein | - |
| MN092_RS19790 (MN092_19790) | - | 3825488..3829960 (-) | 4473 | Protein_3870 | phage tail tape measure protein | - |
| MN092_RS19795 (MN092_19795) | gpG | 3830169..3830531 (-) | 363 | WP_003185339.1 | phage tail assembly chaperone G | - |
| MN092_RS19800 (MN092_19800) | - | 3830585..3831202 (-) | 618 | WP_003185341.1 | major tail protein | - |
| MN092_RS19805 (MN092_19805) | - | 3831217..3831600 (-) | 384 | WP_003185344.1 | hypothetical protein | - |
| MN092_RS19810 (MN092_19810) | - | 3831597..3831995 (-) | 399 | WP_003185346.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MN092_RS19815 (MN092_19815) | - | 3831995..3832303 (-) | 309 | WP_003185349.1 | phage head closure protein | - |
| MN092_RS19820 (MN092_19820) | - | 3832293..3832595 (-) | 303 | WP_003185351.1 | head-tail connector protein | - |
| MN092_RS19825 (MN092_19825) | - | 3832616..3833041 (-) | 426 | WP_003185353.1 | collagen-like protein | - |
| MN092_RS19830 (MN092_19830) | - | 3833065..3834348 (-) | 1284 | WP_048350601.1 | phage major capsid protein | - |
| MN092_RS19835 (MN092_19835) | - | 3834387..3835118 (-) | 732 | WP_061565933.1 | head maturation protease, ClpP-related | - |
| MN092_RS19840 (MN092_19840) | - | 3835063..3836373 (-) | 1311 | WP_003185359.1 | phage portal protein | - |
| MN092_RS19845 (MN092_19845) | - | 3836374..3836565 (-) | 192 | WP_003185361.1 | DUF1056 family protein | - |
| MN092_RS19850 (MN092_19850) | - | 3836577..3838286 (-) | 1710 | WP_003185362.1 | terminase large subunit | - |
| MN092_RS19855 (MN092_19855) | - | 3838283..3838798 (-) | 516 | WP_003185364.1 | phage terminase small subunit P27 family | - |
| MN092_RS19860 (MN092_19860) | - | 3839028..3839402 (-) | 375 | WP_061565934.1 | HNH endonuclease | - |
| MN092_RS19865 (MN092_19865) | - | 3839808..3841052 (-) | 1245 | WP_061565936.1 | ComF family protein | - |
| MN092_RS19870 (MN092_19870) | - | 3841027..3842259 (-) | 1233 | WP_061565937.1 | DNA-processing protein DprA | - |
| MN092_RS19875 (MN092_19875) | cotD | 3842577..3842801 (-) | 225 | WP_003185368.1 | spore coat protein CotD | - |
| MN092_RS19880 (MN092_19880) | - | 3843551..3843931 (-) | 381 | WP_009330080.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MN092_RS19885 (MN092_19885) | - | 3844058..3844330 (-) | 273 | WP_009329245.1 | DUF5052 family protein | - |
| MN092_RS19890 (MN092_19890) | - | 3844327..3844722 (-) | 396 | WP_009329247.1 | YopX family protein | - |
| MN092_RS19895 (MN092_19895) | - | 3844738..3845253 (-) | 516 | WP_009329249.1 | putative metallopeptidase | - |
| MN092_RS19900 (MN092_19900) | fbpA | 3845257..3845427 (-) | 171 | WP_017695850.1 | Fur-regulated basic protein FbpA | - |
| MN092_RS19905 (MN092_19905) | - | 3845424..3845963 (-) | 540 | WP_020450341.1 | ERCC4 domain-containing protein | - |
| MN092_RS19910 (MN092_19910) | - | 3845960..3846397 (-) | 438 | WP_061565938.1 | hypothetical protein | - |
| MN092_RS19915 (MN092_19915) | - | 3846639..3849065 (-) | 2427 | WP_061565939.1 | phage/plasmid primase, P4 family | - |
| MN092_RS19920 (MN092_19920) | - | 3849126..3849563 (-) | 438 | WP_061565940.1 | DUF669 domain-containing protein | - |
| MN092_RS19925 (MN092_19925) | - | 3849563..3850495 (-) | 933 | WP_061565941.1 | AAA family ATPase | - |
| MN092_RS19930 (MN092_19930) | - | 3850499..3851056 (-) | 558 | WP_061565942.1 | host-nuclease inhibitor Gam family protein | - |
| MN092_RS19935 (MN092_19935) | - | 3851149..3851391 (-) | 243 | WP_011198322.1 | hypothetical protein | - |
| MN092_RS19940 (MN092_19940) | - | 3851479..3851745 (-) | 267 | WP_061565943.1 | YqaH family protein | - |
| MN092_RS19945 (MN092_19945) | - | 3851805..3852185 (+) | 381 | WP_003185396.1 | DUF2513 domain-containing protein | - |
| MN092_RS19950 (MN092_19950) | - | 3852177..3852347 (-) | 171 | WP_003185398.1 | hypothetical protein | - |
| MN092_RS19955 (MN092_19955) | - | 3852691..3853245 (-) | 555 | WP_003185401.1 | hypothetical protein | - |
| MN092_RS19960 (MN092_19960) | - | 3853303..3853491 (-) | 189 | WP_016886536.1 | hypothetical protein | - |
| MN092_RS19965 (MN092_19965) | - | 3853623..3853811 (-) | 189 | WP_003185403.1 | helix-turn-helix transcriptional regulator | - |
| MN092_RS19970 (MN092_19970) | - | 3853808..3854602 (-) | 795 | WP_003185404.1 | ORF6N domain-containing protein | - |
| MN092_RS19975 (MN092_19975) | - | 3854627..3854890 (-) | 264 | WP_227592746.1 | helix-turn-helix domain-containing protein | - |
| MN092_RS19980 (MN092_19980) | - | 3855017..3855655 (+) | 639 | WP_003185408.1 | LexA family protein | - |
| MN092_RS19985 (MN092_19985) | - | 3855726..3856820 (+) | 1095 | WP_003185410.1 | tyrosine-type recombinase/integrase | - |
| MN092_RS19995 (MN092_19995) | smpB | 3857372..3857845 (-) | 474 | WP_009329604.1 | SsrA-binding protein SmpB | - |
| MN092_RS20000 (MN092_20000) | rnr | 3857957..3860260 (-) | 2304 | WP_003185414.1 | ribonuclease R | - |
| MN092_RS20005 (MN092_20005) | - | 3860274..3861020 (-) | 747 | WP_003185416.1 | alpha/beta hydrolase | - |
| MN092_RS20010 (MN092_20010) | secG | 3861161..3861391 (-) | 231 | WP_003185418.1 | preprotein translocase subunit SecG | - |
| MN092_RS20015 (MN092_20015) | abrB | 3861562..3861846 (-) | 285 | WP_003185421.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| MN092_RS20020 (MN092_20020) | - | 3861875..3862108 (-) | 234 | WP_085959538.1 | helix-turn-helix domain-containing protein | - |
| MN092_RS20025 (MN092_20025) | - | 3862261..3862662 (+) | 402 | WP_009329609.1 | transcriptional regulator | - |
| MN092_RS20030 (MN092_20030) | - | 3862832..3863230 (+) | 399 | WP_009329610.1 | helix-turn-helix domain-containing protein | - |
| MN092_RS20035 (MN092_20035) | - | 3863278..3863955 (-) | 678 | WP_003185432.1 | ABC transporter permease | - |
| MN092_RS20040 (MN092_20040) | opuCC | 3863972..3864889 (-) | 918 | WP_009329611.1 | osmoprotectant ABC transporter substrate-binding lipoprotein OpuCC | - |
| MN092_RS20045 (MN092_20045) | - | 3864903..3865556 (-) | 654 | WP_009329612.1 | ABC transporter permease | - |
| MN092_RS20050 (MN092_20050) | - | 3865578..3866717 (-) | 1140 | WP_003185439.1 | betaine/proline/choline family ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10486.36 Da Isoelectric Point: 7.9620
>NTDB_id=663088 MN092_RS20015 WP_003185421.1 3861562..3861846(-) (abrB) [Bacillus licheniformis strain DSM 13]
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
MKNTGIVRRIDELGRVVLPVEMRRVLNINEKDPLEIYTDGENIILTKYAANMACLMTGDITTKNKTYAGGKIVLSPRGAE
MLLEDMMAALSEKK
Nucleotide
Download Length: 285 bp
>NTDB_id=663088 MN092_RS20015 WP_003185421.1 3861562..3861846(-) (abrB) [Bacillus licheniformis strain DSM 13]
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
GTGAAAAATACCGGGATTGTCCGGAGAATCGATGAGCTCGGCAGAGTCGTTCTCCCGGTCGAAATGCGCAGGGTGCTGAA
TATCAATGAAAAGGACCCGCTCGAAATATATACCGACGGCGAAAACATCATTTTGACAAAATACGCCGCAAACATGGCAT
GTTTGATGACCGGCGACATCACCACGAAAAATAAAACGTATGCGGGCGGCAAAATCGTACTCAGCCCGCGCGGAGCGGAA
ATGCTCCTGGAAGATATGATGGCGGCACTGTCAGAAAAGAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.044 |
96.809 |
0.543 |