Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MN092_RS18365 Genome accession   NZ_CP093290
Coordinates   3561545..3561685 (-) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus licheniformis strain DSM 13     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3556545..3566685
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MN092_RS18340 (MN092_18340) - 3556816..3557205 (-) 390 WP_003184847.1 hotdog fold thioesterase -
  MN092_RS18345 (MN092_18345) comA 3557222..3557860 (-) 639 WP_003184849.1 response regulator transcription factor Regulator
  MN092_RS18350 (MN092_18350) comP 3557947..3560268 (-) 2322 WP_026080865.1 ATP-binding protein Regulator
  MN092_RS18355 (MN092_18355) comX 3560308..3560472 (-) 165 WP_011198251.1 competence pheromone ComX -
  MN092_RS18360 (MN092_18360) - 3560487..3561356 (-) 870 WP_011198252.1 polyprenyl synthetase family protein -
  MN092_RS18365 (MN092_18365) degQ 3561545..3561685 (-) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  MN092_RS18370 (MN092_18370) - 3562171..3562518 (+) 348 WP_009329512.1 hypothetical protein -
  MN092_RS18375 (MN092_18375) - 3562561..3563781 (-) 1221 WP_003184864.1 EAL and HDOD domain-containing protein -
  MN092_RS18380 (MN092_18380) - 3563960..3565369 (-) 1410 WP_228767691.1 nicotinate phosphoribosyltransferase -
  MN092_RS18385 (MN092_18385) - 3565447..3565998 (-) 552 WP_003184868.1 cysteine hydrolase family protein -
  MN092_RS18390 (MN092_18390) - 3566183..3566584 (-) 402 WP_003184870.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=663085 MN092_RS18365 WP_003184860.1 3561545..3561685(-) (degQ) [Bacillus licheniformis strain DSM 13]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=663085 MN092_RS18365 WP_003184860.1 3561545..3561685(-) (degQ) [Bacillus licheniformis strain DSM 13]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652