Detailed information    

insolico Bioinformatically predicted

Overview


Name   nucA/comI   Type   Machinery gene
Locus tag   MNG38_RS13175 Genome accession   NZ_CP093289
Coordinates   2552089..2552499 (-) Length   136 a.a.
NCBI ID   WP_009967785.1    Uniprot ID   A0A6I4D881
Organism   Bacillus subtilis strain H2     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2547622..2598948 2552089..2552499 within 0


Gene organization within MGE regions


Location: 2547622..2598948
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MNG38_RS13150 (MNG38_13150) yqeF 2547622..2548353 (-) 732 WP_003229964.1 SGNH/GDSL hydrolase family protein -
  MNG38_RS13155 (MNG38_13155) cwlH 2548605..2549357 (-) 753 WP_015251672.1 N-acetylmuramoyl-L-alanine amidase CwlH -
  MNG38_RS13160 (MNG38_13160) yqeD 2549544..2550170 (+) 627 WP_015251671.1 TVP38/TMEM64 family protein -
  MNG38_RS13165 (MNG38_13165) gnd 2550189..2551082 (-) 894 WP_015251670.1 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) -
  MNG38_RS13170 (MNG38_13170) yqeB 2551334..2552056 (+) 723 WP_010886572.1 hypothetical protein -
  MNG38_RS13175 (MNG38_13175) nucA/comI 2552089..2552499 (-) 411 WP_009967785.1 sporulation-specific Dnase NucB Machinery gene
  MNG38_RS13180 (MNG38_13180) - 2552695..2553045 (+) 351 Protein_2554 sigma-70 family RNA polymerase sigma factor -
  MNG38_RS13185 (MNG38_13185) spoIVCA 2553073..2554533 (-) 1461 WP_223257626.1 site-specific DNA recombinase SpoIVCA -
  MNG38_RS13190 (MNG38_13190) - 2554491..2554669 (-) 179 Protein_2556 hypothetical protein -
  MNG38_RS13195 (MNG38_13195) arsC 2555024..2555443 (-) 420 WP_004398596.1 thioredoxin-dependent arsenate reductase -
  MNG38_RS13200 (MNG38_13200) acr3 2555455..2556495 (-) 1041 WP_032722149.1 arsenite efflux transporter Acr3 -
  MNG38_RS13205 (MNG38_13205) arsK 2556518..2556958 (-) 441 WP_032722151.1 ArsI/CadI family heavy metal resistance metalloenzyme -
  MNG38_RS13210 (MNG38_13210) arsR 2557017..2557334 (-) 318 WP_029318103.1 arsenical resistance operon transcriptional regulator ArsR -
  MNG38_RS13215 (MNG38_13215) yqcI 2557706..2558470 (-) 765 WP_017696291.1 YqcI/YcgG family protein -
  MNG38_RS13220 (MNG38_13220) rapE 2558913..2560040 (+) 1128 WP_004398842.1 response regulator aspartate phosphatase RapE -
  MNG38_RS13225 (MNG38_13225) phrE 2560030..2560164 (+) 135 WP_004398770.1 phosphatase RapE inhibitor PhrE -
  MNG38_RS13230 (MNG38_13230) - 2560274..2560432 (+) 159 WP_003245945.1 hypothetical protein -
  MNG38_RS13235 (MNG38_13235) yqcG 2560802..2562397 (+) 1596 WP_004399034.1 LXG family T7SS effector endonuclease toxin YqcG -
  MNG38_RS13240 (MNG38_13240) yqcF 2562412..2562990 (+) 579 WP_009967790.1 type VII secretion system immunity protein YqcF -
  MNG38_RS13245 (MNG38_13245) - 2563108..2563254 (+) 147 WP_009967791.1 hypothetical protein -
  MNG38_RS13250 (MNG38_13250) - 2563251..2563613 (-) 363 WP_003229947.1 hypothetical protein -
  MNG38_RS13255 (MNG38_13255) - 2563629..2564108 (-) 480 WP_004399085.1 hypothetical protein -
  MNG38_RS13260 (MNG38_13260) cwlA 2564273..2565091 (-) 819 WP_017697459.1 N-acetylmuramoyl-L-alanine amidase CwlA -
  MNG38_RS13265 (MNG38_13265) skhD 2565136..2565558 (-) 423 WP_017697460.1 holin family protein -
  MNG38_RS13270 (MNG38_13270) xepA 2565604..2566497 (-) 894 WP_032722160.1 phage-like element PBSX protein XepA -
  MNG38_RS13275 (MNG38_13275) yqcE 2566585..2566749 (-) 165 WP_003229944.1 XkdX family protein -
  MNG38_RS13280 (MNG38_13280) yqcD 2566746..2567081 (-) 336 WP_009967793.1 XkdW family protein -
  MNG38_RS13285 (MNG38_13285) yqcC 2567091..2568191 (-) 1101 WP_032722161.1 pyocin knob domain-containing protein -
  MNG38_RS13290 (MNG38_13290) - 2568195..2568467 (-) 273 WP_032722163.1 hypothetical protein -
  MNG38_RS13295 (MNG38_13295) yqcA 2568464..2569042 (-) 579 WP_032722164.1 YmfQ family protein -
  MNG38_RS13300 (MNG38_13300) yqbT 2569026..2570072 (-) 1047 WP_032722165.1 baseplate J/gp47 family protein -
  MNG38_RS13305 (MNG38_13305) yqbS 2570065..2570490 (-) 426 WP_032722166.1 DUF2634 domain-containing protein -
  MNG38_RS13310 (MNG38_13310) yqbR 2570503..2570769 (-) 267 WP_032722167.1 DUF2577 family protein -
  MNG38_RS13315 (MNG38_13315) - 2570766..2571746 (-) 981 WP_032722168.1 hypothetical protein -
  MNG38_RS13320 (MNG38_13320) yqbP 2571759..2572418 (-) 660 WP_032722169.1 LysM peptidoglycan-binding domain-containing protein -
  MNG38_RS13325 (MNG38_13325) yqbO 2572411..2577168 (-) 4758 WP_043940167.1 phage tail tape measure protein -
  MNG38_RS13330 (MNG38_13330) - 2577171..2577308 (-) 138 WP_021480099.1 hypothetical protein -
  MNG38_RS13335 (MNG38_13335) - 2577350..2577799 (-) 450 WP_032722171.1 phage tail assembly chaperone -
  MNG38_RS13340 (MNG38_13340) txpA 2577945..2578124 (+) 180 WP_004398662.1 type I toxin-antitoxin system toxin TxpA -
  MNG38_RS13345 (MNG38_13345) bsrH 2578504..2578593 (+) 90 WP_075058862.1 type I toxin-antitoxin system toxin BsrH -
  MNG38_RS13350 (MNG38_13350) yqbM 2578847..2579290 (-) 444 WP_003229930.1 phage tail tube protein -
  MNG38_RS13355 (MNG38_13355) yqbK 2579293..2580693 (-) 1401 WP_003229929.1 phage tail sheath family protein -
  MNG38_RS13360 (MNG38_13360) - 2580694..2580885 (-) 192 WP_010886574.1 hypothetical protein -
  MNG38_RS13365 (MNG38_13365) yqbJ 2580882..2581319 (-) 438 WP_003229927.1 DUF6838 family protein -
  MNG38_RS13370 (MNG38_13370) yqbI 2581332..2581835 (-) 504 WP_003246050.1 HK97 gp10 family phage protein -
  MNG38_RS13375 (MNG38_13375) yqbH 2581832..2582194 (-) 363 WP_003229925.1 YqbH/XkdH family protein -
  MNG38_RS13380 (MNG38_13380) gkpG 2582191..2582586 (-) 396 WP_004398566.1 DUF3199 family protein -
  MNG38_RS13385 (MNG38_13385) yqbF 2582590..2582901 (-) 312 WP_003229923.1 YqbF domain-containing protein -
  MNG38_RS13390 (MNG38_13390) skdG 2582912..2583847 (-) 936 WP_003229922.1 phage major capsid protein -
  MNG38_RS13395 (MNG38_13395) yqbD 2583866..2584834 (-) 969 WP_003229921.1 XkdF-like putative serine protease domain-containing protein -
  MNG38_RS13400 (MNG38_13400) - 2584867..2585520 (-) 654 WP_003229920.1 hypothetical protein -
  MNG38_RS13405 (MNG38_13405) yqbB 2585561..2586478 (-) 918 WP_004398748.1 phage head morphogenesis protein -
  MNG38_RS13410 (MNG38_13410) yqbA 2586475..2588007 (-) 1533 WP_004398894.1 phage portal protein -
  MNG38_RS13415 (MNG38_13415) stmB 2588011..2589306 (-) 1296 WP_003229917.1 PBSX family phage terminase large subunit -
  MNG38_RS13420 (MNG38_13420) terS 2589299..2590018 (-) 720 WP_003229916.1 phage terminase small subunit -
  MNG38_RS13425 (MNG38_13425) - 2590086..2590550 (-) 465 WP_004398685.1 hypothetical protein -
  MNG38_RS13430 (MNG38_13430) yqaQ 2590694..2591149 (-) 456 WP_004398775.1 hypothetical protein -
  MNG38_RS13435 (MNG38_13435) - 2591347..2592276 (+) 930 WP_003229913.1 hypothetical protein -
  MNG38_RS13440 (MNG38_13440) yqaO 2592350..2592556 (-) 207 WP_003229912.1 XtrA/YqaO family protein -
  MNG38_RS13445 (MNG38_13445) yqaN 2592638..2593066 (-) 429 WP_009967809.1 RusA family crossover junction endodeoxyribonuclease -
  MNG38_RS13450 (MNG38_13450) - 2593162..2593311 (-) 150 WP_003229910.1 hypothetical protein -
  MNG38_RS13455 (MNG38_13455) sknM 2593302..2594243 (-) 942 WP_075058863.1 ATP-binding protein -
  MNG38_RS13460 (MNG38_13460) yqaL 2594125..2594802 (-) 678 WP_116362964.1 DnaD domain-containing protein -
  MNG38_RS13465 (MNG38_13465) recT 2594878..2595732 (-) 855 WP_003229907.1 recombinase RecT -
  MNG38_RS13470 (MNG38_13470) yqaJ 2595735..2596694 (-) 960 WP_004398673.1 YqaJ viral recombinase family protein -
  MNG38_RS13475 (MNG38_13475) yqaI 2596800..2596994 (-) 195 WP_003229905.1 YqaI family protein -
  MNG38_RS13480 (MNG38_13480) - 2596954..2597127 (-) 174 WP_119123069.1 hypothetical protein -
  MNG38_RS13485 (MNG38_13485) sknH 2597124..2597381 (-) 258 WP_003245994.1 YqaH family protein -
  MNG38_RS13490 (MNG38_13490) yqaG 2597378..2597947 (-) 570 WP_004398626.1 helix-turn-helix domain-containing protein -
  MNG38_RS13495 (MNG38_13495) - 2598021..2598161 (-) 141 WP_003229902.1 hypothetical protein -
  MNG38_RS13500 (MNG38_13500) yqaF 2598191..2598421 (-) 231 WP_004398958.1 helix-turn-helix transcriptional regulator -
  MNG38_RS13505 (MNG38_13505) sknR 2598598..2598948 (+) 351 WP_004398704.1 transcriptional regulator SknR -

Sequence


Protein


Download         Length: 136 a.a.        Molecular weight: 14967.97 Da        Isoelectric Point: 5.1853

>NTDB_id=663000 MNG38_RS13175 WP_009967785.1 2552089..2552499(-) (nucA/comI) [Bacillus subtilis strain H2]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Nucleotide


Download         Length: 411 bp        

>NTDB_id=663000 MNG38_RS13175 WP_009967785.1 2552089..2552499(-) (nucA/comI) [Bacillus subtilis strain H2]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCTGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGCTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGAGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTACGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6I4D881

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

62.609

84.559

0.529