Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MMZ59_RS14625 Genome accession   NZ_CP093150
Coordinates   2844323..2844463 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain JYY-02     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2839323..2849463
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MMZ59_RS14600 (MMZ59_14600) - 2839645..2840034 (-) 390 WP_017358943.1 hotdog fold thioesterase -
  MMZ59_RS14605 (MMZ59_14605) comA 2840058..2840699 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  MMZ59_RS14610 (MMZ59_14610) comP 2840780..2843086 (-) 2307 WP_241511426.1 ATP-binding protein Regulator
  MMZ59_RS14615 (MMZ59_14615) comX 2843100..2843270 (-) 171 WP_017358941.1 competence pheromone ComX -
  MMZ59_RS14620 (MMZ59_14620) - 2843248..2844171 (-) 924 WP_335372458.1 polyprenyl synthetase family protein -
  MMZ59_RS14625 (MMZ59_14625) degQ 2844323..2844463 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  MMZ59_RS14630 (MMZ59_14630) - 2844969..2845322 (+) 354 WP_019744042.1 hypothetical protein -
  MMZ59_RS14635 (MMZ59_14635) - 2845359..2846585 (-) 1227 WP_241511958.1 EAL and HDOD domain-containing protein -
  MMZ59_RS14640 (MMZ59_14640) - 2846727..2848196 (-) 1470 WP_007500472.1 nicotinate phosphoribosyltransferase -
  MMZ59_RS14645 (MMZ59_14645) - 2848214..2848765 (-) 552 WP_046526549.1 cysteine hydrolase family protein -
  MMZ59_RS14650 (MMZ59_14650) - 2848826..2849233 (-) 408 WP_056702629.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=661963 MMZ59_RS14625 WP_003213123.1 2844323..2844463(-) (degQ) [Bacillus altitudinis strain JYY-02]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=661963 MMZ59_RS14625 WP_003213123.1 2844323..2844463(-) (degQ) [Bacillus altitudinis strain JYY-02]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696