Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   MKF36_RS14580 Genome accession   NZ_CP092750
Coordinates   2951497..2951637 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain KS04AU     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2946497..2956637
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKF36_RS14555 (MKF36_14555) - 2946837..2947220 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  MKF36_RS14560 (MKF36_14560) comA 2947242..2947886 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  MKF36_RS14565 (MKF36_14565) comP 2947967..2950258 (-) 2292 WP_042635452.1 histidine kinase Regulator
  MKF36_RS14570 (MKF36_14570) comX 2950270..2950434 (-) 165 WP_007613432.1 competence pheromone ComX -
  MKF36_RS14575 (MKF36_14575) - 2950434..2951345 (-) 912 WP_079891433.1 polyprenyl synthetase family protein -
  MKF36_RS14580 (MKF36_14580) degQ 2951497..2951637 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  MKF36_RS14585 (MKF36_14585) - 2952102..2952443 (+) 342 WP_042635453.1 hypothetical protein -
  MKF36_RS14590 (MKF36_14590) - 2952450..2953673 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  MKF36_RS14595 (MKF36_14595) - 2953803..2955269 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  MKF36_RS14600 (MKF36_14600) - 2955287..2955838 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  MKF36_RS14605 (MKF36_14605) - 2955935..2956333 (-) 399 WP_042635454.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=660047 MKF36_RS14580 WP_003152043.1 2951497..2951637(-) (degQ) [Bacillus velezensis strain KS04AU]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=660047 MKF36_RS14580 WP_003152043.1 2951497..2951637(-) (degQ) [Bacillus velezensis strain KS04AU]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891