Detailed information    

insolico Bioinformatically predicted

Overview

Name   rcrR   Type   Regulator
Locus tag   SMUNUM_RS04355 Genome accession   NZ_AP014571
Coordinates   879311..879745 (+) Length   144 a.a.
NCBI ID   WP_002263292.1    Uniprot ID   A0AAX1K4B8
Organism   Streptococcus mutans LP13     
Function   regulate competence (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 845247..883295 879311..879745 within 0


Gene organization within MGE regions


Location: 845247..883295
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SMUNUM_RS04220 (SMNUM_0785) ugpC 845247..846380 (+) 1134 WP_002262876.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
  SMUNUM_RS04225 (SMNUM_0786) dexB 846471..848081 (+) 1611 WP_002265095.1 glucan 1,6-alpha-glucosidase DexB -
  SMUNUM_RS04230 (SMNUM_0787) - 848243..849241 (-) 999 WP_002269396.1 LacI family DNA-binding transcriptional regulator -
  SMUNUM_RS04235 (SMNUM_0788) - 849384..850556 (+) 1173 WP_002269395.1 galactokinase -
  SMUNUM_RS04240 (SMNUM_0789) galT 850561..852036 (+) 1476 WP_002282715.1 UDP-glucose--hexose-1-phosphate uridylyltransferase -
  SMUNUM_RS04245 (SMNUM_0790) galE 852185..853186 (+) 1002 WP_002262881.1 UDP-glucose 4-epimerase GalE -
  SMUNUM_RS04250 (SMNUM_0791) - 853454..854533 (+) 1080 WP_002262882.1 serine hydrolase -
  SMUNUM_RS04255 - 854776..855279 (+) 504 WP_002265100.1 phosphatase PAP2 family protein -
  SMUNUM_RS04260 (SMNUM_0793) - 855442..856047 (+) 606 WP_002265101.1 TetR/AcrR family transcriptional regulator -
  SMUNUM_RS04265 (SMNUM_0794) - 856122..856838 (+) 717 WP_002265102.1 ABC transporter ATP-binding protein -
  SMUNUM_RS04270 (SMNUM_0795) - 856825..858366 (+) 1542 WP_168747525.1 hypothetical protein -
  SMUNUM_RS04275 (SMNUM_0797) - 858475..858849 (+) 375 WP_002262891.1 DUF1149 family protein -
  SMUNUM_RS04280 (SMNUM_0798) - 858855..859700 (+) 846 WP_002266545.1 DegV family protein -
  SMUNUM_RS04285 (SMNUM_0799) dapB 859712..860479 (+) 768 WP_002262893.1 4-hydroxy-tetrahydrodipicolinate reductase -
  SMUNUM_RS04290 (SMNUM_0800) - 860476..861681 (+) 1206 WP_168747523.1 CCA tRNA nucleotidyltransferase -
  SMUNUM_RS04295 (SMNUM_0801) - 861684..863552 (+) 1869 WP_002266716.1 ABC-F family ATP-binding cassette domain-containing protein -
  SMUNUM_RS04300 (SMNUM_0802) - 864009..865745 (+) 1737 WP_019805395.1 ABC transporter ATP-binding protein -
  SMUNUM_RS04305 (SMNUM_0803) - 865756..867528 (+) 1773 WP_019805396.1 ABC transporter ATP-binding protein -
  SMUNUM_RS04310 (SMNUM_0804) - 867644..868564 (+) 921 WP_002269023.1 AEC family transporter -
  SMUNUM_RS04315 (SMNUM_0805) gtfD 868785..873173 (+) 4389 WP_168749693.1 glucosyltransferase-S -
  SMUNUM_RS04320 (SMNUM_0806) - 873348..873857 (-) 510 WP_002262901.1 DUF308 domain-containing protein -
  SMUNUM_RS04325 (SMNUM_0807) gdhA 874493..875842 (+) 1350 WP_002263849.1 NADP-specific glutamate dehydrogenase -
  SMUNUM_RS04330 (SMNUM_0808) - 875954..876337 (-) 384 WP_002263287.1 DUF3021 family protein -
  SMUNUM_RS04335 (SMNUM_0809) queF 876446..876934 (-) 489 WP_002263288.1 preQ(1) synthase -
  SMUNUM_RS04340 (SMNUM_0810) queE 876947..877663 (-) 717 WP_002263289.1 7-carboxy-7-deazaguanine synthase QueE -
  SMUNUM_RS04345 (SMNUM_0811) queD 877660..878106 (-) 447 WP_002263290.1 6-carboxytetrahydropterin synthase QueD -
  SMUNUM_RS04350 (SMNUM_0812) queC 878106..878759 (-) 654 WP_002263291.1 7-cyano-7-deazaguanine synthase QueC -
  SMUNUM_RS04355 (SMNUM_0813) rcrR 879311..879745 (+) 435 WP_002263292.1 MarR family winged helix-turn-helix transcriptional regulator Regulator
  SMUNUM_RS04360 (SMNUM_0814) rcrP 879749..881551 (+) 1803 WP_002263293.1 ATP-binding cassette domain-containing protein Regulator
  SMUNUM_RS04365 (SMNUM_0815) rcrQ 881541..883295 (+) 1755 WP_002263294.1 ABC transporter ATP-binding protein Regulator

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 16720.58 Da        Isoelectric Point: 10.5126

>NTDB_id=65971 SMUNUM_RS04355 WP_002263292.1 879311..879745(+) (rcrR) [Streptococcus mutans LP13]
MKEPFSEFKNLITATERYIQELSKSHGVEHLSGPQGWTVMFLKDNQGKEIFIKDIEKRLDISKSVTSNLIKRMEKNGFIS
VIPSRKDRRYKQIVLTPLGQEKAGKITVFLTDLKKLLLKDISQEDLSVARKVFKQIKQNLEKKE

Nucleotide


Download         Length: 435 bp        

>NTDB_id=65971 SMUNUM_RS04355 WP_002263292.1 879311..879745(+) (rcrR) [Streptococcus mutans LP13]
ATGAAGGAGCCTTTTAGTGAATTTAAAAACCTCATTACAGCAACAGAAAGATATATTCAAGAATTATCCAAAAGCCATGG
TGTTGAACATCTGTCCGGACCTCAGGGATGGACAGTTATGTTTTTAAAGGATAATCAAGGAAAGGAAATTTTTATTAAAG
ATATTGAAAAAAGGTTAGATATCTCAAAATCTGTGACCAGTAATCTCATTAAACGAATGGAAAAAAATGGTTTTATTTCT
GTTATTCCTTCCAGAAAAGACAGACGATACAAGCAAATTGTTTTAACGCCATTAGGTCAGGAAAAAGCTGGAAAAATAAC
TGTTTTTTTAACAGATCTTAAAAAGTTGCTTCTAAAAGATATTAGTCAGGAAGACTTATCAGTTGCTCGGAAGGTTTTTA
AACAAATCAAACAAAATTTAGAAAAGAAGGAGTAA

Domains

Predicted by InterproScan.

MarR family (MarR_2)

(31-89)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rcrR Streptococcus mutans UA159

100

100

1

Multiple sequence alignment