Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MKS87_RS13390 Genome accession   NZ_CP092631
Coordinates   2574176..2574349 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain YB-15     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2569176..2579349
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKS87_RS13375 (MKS87_13375) gcvT 2569975..2571063 (-) 1089 WP_173614183.1 glycine cleavage system aminomethyltransferase GcvT -
  MKS87_RS13380 (MKS87_13380) yqhH 2571505..2573178 (+) 1674 WP_173614184.1 SNF2-related protein -
  MKS87_RS13385 (MKS87_13385) yqhG 2573199..2573993 (+) 795 WP_003230200.1 YqhG family protein -
  MKS87_RS13390 (MKS87_13390) sinI 2574176..2574349 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MKS87_RS13395 (MKS87_13395) sinR 2574383..2574718 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MKS87_RS13400 (MKS87_13400) tasA 2574811..2575596 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MKS87_RS13405 (MKS87_13405) sipW 2575660..2576232 (-) 573 WP_003246088.1 signal peptidase I -
  MKS87_RS13410 (MKS87_13410) tapA 2576216..2576977 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  MKS87_RS13415 (MKS87_13415) yqzG 2577249..2577575 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  MKS87_RS13420 (MKS87_13420) spoIIT 2577617..2577796 (-) 180 WP_029726723.1 YqzE family protein -
  MKS87_RS13425 (MKS87_13425) comGG 2577868..2578242 (-) 375 WP_029726722.1 ComG operon protein ComGG Machinery gene
  MKS87_RS13430 (MKS87_13430) comGF 2578243..2578626 (-) 384 WP_029317913.1 ComG operon protein ComGF Machinery gene
  MKS87_RS13435 (MKS87_13435) comGE 2578652..2578999 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=659357 MKS87_RS13390 WP_003230187.1 2574176..2574349(+) (sinI) [Bacillus subtilis strain YB-15]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=659357 MKS87_RS13390 WP_003230187.1 2574176..2574349(+) (sinI) [Bacillus subtilis strain YB-15]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1