Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MF598_RS07950 Genome accession   NZ_CP092185
Coordinates   1521688..1521861 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain K203     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1516688..1526861
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MF598_RS07900 (MF598_07900) comGD 1516808..1517245 (+) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  MF598_RS07905 (MF598_07905) comGE 1517229..1517543 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  MF598_RS07910 (MF598_07910) comGF 1517452..1517952 (+) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  MF598_RS07915 (MF598_07915) comGG 1517953..1518330 (+) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  MF598_RS07920 (MF598_07920) - 1518387..1518566 (+) 180 WP_003153093.1 YqzE family protein -
  MF598_RS07925 (MF598_07925) - 1518606..1518935 (-) 330 WP_020954231.1 DUF3889 domain-containing protein -
  MF598_RS07930 (MF598_07930) tapA 1519194..1519865 (+) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  MF598_RS07935 (MF598_07935) - 1519837..1520421 (+) 585 WP_007408328.1 signal peptidase I -
  MF598_RS07940 (MF598_07940) - 1520486..1521271 (+) 786 WP_007408329.1 TasA family protein -
  MF598_RS07945 (MF598_07945) sinR 1521319..1521654 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MF598_RS07950 (MF598_07950) sinI 1521688..1521861 (-) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MF598_RS07955 (MF598_07955) - 1522038..1522832 (-) 795 WP_007408330.1 YqhG family protein -
  MF598_RS07960 (MF598_07960) - 1522854..1524524 (-) 1671 WP_224223673.1 SNF2-related protein -
  MF598_RS07965 (MF598_07965) gcvT 1524948..1526048 (+) 1101 WP_045208234.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=656253 MF598_RS07950 WP_003153105.1 1521688..1521861(-) (sinI) [Bacillus velezensis strain K203]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=656253 MF598_RS07950 WP_003153105.1 1521688..1521861(-) (sinI) [Bacillus velezensis strain K203]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702