Detailed information    

insolico Bioinformatically predicted

Overview


Name   rocC   Type   Regulator
Locus tag   MBG98_RS00690 Genome accession   NZ_CP092038
Coordinates   157043..157735 (+) Length   230 a.a.
NCBI ID   WP_010945894.1    Uniprot ID   Q5ZZ78
Organism   Legionella pneumophila strain 11052018-5     
Function   rocR chaperone; repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 145134..220543 157043..157735 within 0


Gene organization within MGE regions


Location: 145134..220543
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MBG98_RS00655 (MBG98_00655) acs 148249..150132 (-) 1884 WP_010945888.1 acetate--CoA ligase -
  MBG98_RS00660 (MBG98_00660) mmsB 150134..151030 (-) 897 WP_015444947.1 3-hydroxyisobutyrate dehydrogenase -
  MBG98_RS00665 (MBG98_00665) - 151054..152553 (-) 1500 WP_015444946.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -
  MBG98_RS00670 (MBG98_00670) - 152664..152840 (-) 177 WP_014840774.1 dodecin domain-containing protein -
  MBG98_RS00675 (MBG98_00675) - 153018..155486 (+) 2469 WP_010945891.1 hypothetical protein -
  MBG98_RS00680 (MBG98_00680) dapB 155590..156321 (-) 732 WP_010945892.1 4-hydroxy-tetrahydrodipicolinate reductase -
  MBG98_RS00685 (MBG98_00685) - 156501..156686 (-) 186 WP_010945893.1 hypothetical protein -
  MBG98_RS00690 (MBG98_00690) rocC 157043..157735 (+) 693 WP_010945894.1 ProQ/FinO family protein Regulator
  MBG98_RS00695 (MBG98_00695) - 157736..158806 (+) 1071 WP_010945895.1 hypothetical protein -
  MBG98_RS00700 (MBG98_00700) sdhB 158906..164533 (-) 5628 WP_010945896.1 Dot/Icm T4SS effector SdhB -
  MBG98_RS00705 (MBG98_00705) pyk 164624..166048 (-) 1425 WP_010945897.1 pyruvate kinase -
  MBG98_RS00710 (MBG98_00710) - 166032..167222 (-) 1191 WP_010945898.1 phosphoglycerate kinase -
  MBG98_RS00715 (MBG98_00715) gap 167233..168225 (-) 993 WP_015444943.1 type I glyceraldehyde-3-phosphate dehydrogenase -
  MBG98_RS00720 (MBG98_00720) tkt 168307..170385 (-) 2079 WP_010945900.1 transketolase -
  MBG98_RS00725 (MBG98_00725) - 170571..171905 (+) 1335 WP_010945901.1 hypothetical protein -
  MBG98_RS00730 (MBG98_00730) - 172004..174019 (+) 2016 WP_015444939.1 M3 family metallopeptidase -
  MBG98_RS00740 (MBG98_00740) - 174850..176154 (-) 1305 WP_011945340.1 tetratricopeptide repeat protein -
  MBG98_RS00745 (MBG98_00745) - 176289..176948 (-) 660 WP_011945341.1 helix-turn-helix domain-containing protein -
  MBG98_RS00750 (MBG98_00750) - 177119..178003 (+) 885 WP_011945342.1 hypothetical protein -
  MBG98_RS00755 (MBG98_00755) - 178020..178331 (+) 312 WP_011945343.1 vir region protein -
  MBG98_RS00760 (MBG98_00760) - 178350..178616 (+) 267 WP_011945344.1 carbon storage regulator -
  MBG98_RS00765 (MBG98_00765) trbB 178629..179594 (+) 966 WP_011945345.1 P-type conjugative transfer ATPase TrbB -
  MBG98_RS00770 (MBG98_00770) - 179607..179984 (+) 378 WP_011945346.1 TrbC/VirB2 family protein -
  MBG98_RS00775 (MBG98_00775) - 179981..180280 (+) 300 WP_011945347.1 conjugal transfer protein TrbD -
  MBG98_RS00780 (MBG98_00780) - 180277..182814 (+) 2538 WP_011945348.1 VirB4 family type IV secretion/conjugal transfer ATPase -
  MBG98_RS00785 (MBG98_00785) - 182811..183554 (+) 744 WP_011945349.1 conjugal transfer protein TrbF -
  MBG98_RS00790 (MBG98_00790) trbG 183551..184426 (+) 876 WP_011945350.1 P-type conjugative transfer protein TrbG -
  MBG98_RS00795 (MBG98_00795) - 184429..184839 (+) 411 WP_011945351.1 conjugal transfer protein TrbH -
  MBG98_RS00800 (MBG98_00800) - 184845..186086 (+) 1242 WP_011945352.1 TrbI/VirB10 family protein -
  MBG98_RS00805 (MBG98_00805) trbJ 186100..186840 (+) 741 WP_011945353.1 P-type conjugative transfer protein TrbJ -
  MBG98_RS00810 (MBG98_00810) - 186870..187082 (+) 213 WP_011945354.1 hypothetical protein -
  MBG98_RS00815 (MBG98_00815) trbL 187087..188502 (+) 1416 WP_013100980.1 P-type conjugative transfer protein TrbL -
  MBG98_RS00820 (MBG98_00820) - 188499..190388 (+) 1890 WP_011945356.1 type IV secretory system conjugative DNA transfer family protein -
  MBG98_RS00825 (MBG98_00825) traF 190385..190930 (+) 546 WP_011945357.1 conjugative transfer signal peptidase TraF -
  MBG98_RS00830 (MBG98_00830) - 190927..191091 (+) 165 WP_011945358.1 hypothetical protein -
  MBG98_RS00835 (MBG98_00835) - 191084..193270 (+) 2187 WP_011945359.1 zincin-like metallopeptidase domain-containing protein -
  MBG98_RS00840 (MBG98_00840) - 193352..193723 (-) 372 WP_011945360.1 ASCH domain-containing protein -
  MBG98_RS00845 (MBG98_00845) - 193701..193895 (-) 195 WP_238501421.1 hypothetical protein -
  MBG98_RS00850 (MBG98_00850) - 193895..195166 (-) 1272 WP_042237775.1 IS256 family transposase -
  MBG98_RS00855 (MBG98_00855) - 195239..196177 (-) 939 WP_238501443.1 N-acetyltransferase -
  MBG98_RS00860 (MBG98_00860) traI 196292..198166 (-) 1875 WP_011945362.1 TraI/MobA(P) family conjugative relaxase -
  MBG98_RS00865 (MBG98_00865) traJ 198163..198516 (-) 354 WP_011945363.1 conjugal transfer transcriptional regulator TraJ -
  MBG98_RS00870 (MBG98_00870) - 198933..199259 (+) 327 WP_013100981.1 TraK family protein -
  MBG98_RS00875 (MBG98_00875) - 199259..199984 (+) 726 WP_011945364.1 ArsA-related P-loop ATPase -
  MBG98_RS00880 (MBG98_00880) - 199984..200439 (+) 456 WP_011945365.1 conjugal transfer protein TraM -
  MBG98_RS00885 (MBG98_00885) - 200453..201097 (+) 645 WP_011945366.1 hypothetical protein -
  MBG98_RS00890 (MBG98_00890) - 201141..201602 (-) 462 WP_011945367.1 nucleoside deaminase -
  MBG98_RS00895 (MBG98_00895) - 201580..203022 (-) 1443 WP_011945368.1 VUT family protein -
  MBG98_RS00900 (MBG98_00900) - 203015..203374 (-) 360 WP_011945369.1 hypothetical protein -
  MBG98_RS00905 (MBG98_00905) - 203392..204045 (-) 654 WP_011945370.1 helix-turn-helix domain-containing protein -
  MBG98_RS00910 (MBG98_00910) - 204183..204422 (+) 240 WP_041931991.1 hypothetical protein -
  MBG98_RS00915 (MBG98_00915) - 204611..205816 (+) 1206 WP_041931961.1 site-specific integrase -
  MBG98_RS00920 (MBG98_00920) - 205822..206637 (-) 816 WP_011945374.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  MBG98_RS00925 (MBG98_00925) - 206634..207425 (-) 792 WP_011945375.1 type IV toxin-antitoxin system AbiEi family antitoxin -
  MBG98_RS00930 (MBG98_00930) - 207948..208739 (+) 792 Protein_182 IS4-like element ISLpn3 family transposase -
  MBG98_RS00935 (MBG98_00935) - 208828..210099 (+) 1272 WP_042237775.1 IS256 family transposase -
  MBG98_RS00940 (MBG98_00940) - 210140..210784 (+) 645 Protein_184 IS4-like element ISLpn3 family transposase -
  MBG98_RS00945 (MBG98_00945) - 210817..211992 (-) 1176 WP_010945905.1 ISL3 family transposase -
  MBG98_RS00950 (MBG98_00950) - 212026..212487 (-) 462 WP_223804307.1 site specific recombinase -
  MBG98_RS00960 (MBG98_00960) - 213799..214128 (+) 330 WP_015444936.1 hypothetical protein -
  MBG98_RS00965 (MBG98_00965) mauJ 214243..215613 (+) 1371 WP_010945909.1 methylamine utilization protein MauJ -
  MBG98_RS00970 (MBG98_00970) - 215745..217085 (-) 1341 WP_010945910.1 hypothetical protein -
  MBG98_RS00975 (MBG98_00975) - 217115..218473 (-) 1359 WP_015444935.1 KAP family P-loop NTPase fold protein -
  MBG98_RS00980 (MBG98_00980) - 218675..219739 (+) 1065 WP_010945912.1 PIN domain-containing protein -

Sequence


Protein


Download         Length: 230 a.a.        Molecular weight: 25741.65 Da        Isoelectric Point: 10.7030

>NTDB_id=655276 MBG98_RS00690 WP_010945894.1 157043..157735(+) (rocC) [Legionella pneumophila strain 11052018-5]
MRKQALHPRTAVINKAQKNQSKRARSDALLWLAANFPEAFDNSLRIRPLKIGIMSDILQHAEKAEQVGISKSKLREAVVL
FTRRLDYLACLKAREVRIDLHGNPVAEVTEEEAEHASMKIKKRVEKSVKNARKQVNAKAANHSHVNSQPSAVSSVKPMNS
FDSHPEPLLPIYPLRSSTYASQNVAMQSAKSPSVVVKHKAPKQYDPDAVARLKEKLGLSRKAEEKKETTE

Nucleotide


Download         Length: 693 bp        

>NTDB_id=655276 MBG98_RS00690 WP_010945894.1 157043..157735(+) (rocC) [Legionella pneumophila strain 11052018-5]
ATGAGAAAGCAGGCGCTGCACCCACGAACCGCTGTCATCAATAAAGCACAAAAAAATCAATCCAAGCGAGCGCGATCTGA
CGCATTATTATGGCTTGCGGCTAATTTCCCTGAGGCATTCGATAATTCTTTGCGTATTCGGCCATTAAAGATTGGTATTA
TGTCTGATATATTGCAGCATGCAGAAAAAGCAGAGCAAGTTGGAATTTCTAAAAGTAAATTAAGGGAAGCTGTTGTTCTT
TTTACCCGTCGTCTTGATTATCTGGCTTGCCTGAAAGCTCGTGAAGTCCGTATTGATTTGCACGGAAATCCAGTAGCCGA
GGTTACTGAGGAAGAAGCTGAGCATGCTTCCATGAAAATTAAAAAACGCGTGGAAAAGAGTGTTAAAAATGCTCGCAAAC
AAGTGAATGCAAAAGCGGCTAATCATTCGCATGTAAATAGTCAGCCAAGTGCAGTTTCCAGCGTTAAGCCAATGAATTCG
TTTGACTCTCATCCTGAGCCTCTTTTGCCAATATATCCTCTCAGAAGCTCTACCTATGCCTCACAAAATGTGGCAATGCA
ATCCGCCAAGTCACCATCCGTCGTAGTCAAACATAAAGCACCAAAGCAATATGATCCGGATGCTGTAGCCCGTTTAAAAG
AAAAATTAGGATTGTCTCGAAAAGCAGAAGAGAAAAAGGAAACAACAGAGTAA

Domains


Predicted by InterproScan.

(26-132)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q5ZZ78

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  rocC Legionella pneumophila str. Paris

97.391

100

0.974