Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | L2I54_RS13205 | Genome accession | NZ_CP091476 |
| Coordinates | 2585012..2585290 (+) | Length | 92 a.a. |
| NCBI ID | WP_061457236.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain GSICC 30237 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2576186..2616848 | 2585012..2585290 | within | 0 |
Gene organization within MGE regions
Location: 2576186..2616848
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L2I54_RS13135 (L2I54_13100) | - | 2576186..2576449 (+) | 264 | WP_002082716.1 | DUF3937 domain-containing protein | - |
| L2I54_RS13140 (L2I54_13105) | - | 2576999..2577319 (+) | 321 | WP_001071366.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| L2I54_RS13145 (L2I54_13110) | - | 2577469..2577603 (+) | 135 | Protein_2518 | site-specific integrase | - |
| L2I54_RS13150 (L2I54_13115) | - | 2577813..2578298 (+) | 486 | WP_002183612.1 | hypothetical protein | - |
| L2I54_RS13155 (L2I54_13120) | - | 2578610..2579311 (+) | 702 | WP_061457231.1 | DUF3962 domain-containing protein | - |
| L2I54_RS13160 (L2I54_13125) | - | 2579350..2580459 (-) | 1110 | WP_061457232.1 | tyrosine-type recombinase/integrase | - |
| L2I54_RS13165 (L2I54_13130) | - | 2581005..2582156 (+) | 1152 | WP_061457233.1 | AimR family lysis-lysogeny pheromone receptor | - |
| L2I54_RS13170 (L2I54_13135) | - | 2582194..2582340 (+) | 147 | WP_000720921.1 | hypothetical protein | - |
| L2I54_RS13175 | - | 2582495..2582623 (+) | 129 | WP_000836783.1 | hypothetical protein | - |
| L2I54_RS13180 (L2I54_13140) | - | 2582661..2583014 (-) | 354 | WP_000491236.1 | helix-turn-helix transcriptional regulator | - |
| L2I54_RS13185 (L2I54_13145) | - | 2583214..2583399 (+) | 186 | WP_061457234.1 | helix-turn-helix transcriptional regulator | - |
| L2I54_RS13190 (L2I54_13150) | - | 2583465..2583731 (+) | 267 | WP_000522030.1 | helix-turn-helix domain-containing protein | - |
| L2I54_RS13195 (L2I54_13155) | - | 2583731..2583895 (+) | 165 | WP_000390287.1 | hypothetical protein | - |
| L2I54_RS13200 (L2I54_13160) | - | 2583953..2585008 (+) | 1056 | WP_061457235.1 | DnaD domain protein | - |
| L2I54_RS13205 (L2I54_13165) | abrB | 2585012..2585290 (+) | 279 | WP_061457236.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| L2I54_RS13210 (L2I54_13170) | - | 2585283..2585642 (+) | 360 | WP_061457237.1 | hypothetical protein | - |
| L2I54_RS13215 (L2I54_13175) | - | 2585661..2585828 (+) | 168 | WP_064774765.1 | DUF3954 domain-containing protein | - |
| L2I54_RS13220 (L2I54_13180) | - | 2585854..2586105 (+) | 252 | WP_061457238.1 | hypothetical protein | - |
| L2I54_RS13225 (L2I54_13185) | - | 2586126..2586635 (+) | 510 | WP_061457239.1 | dUTP diphosphatase | - |
| L2I54_RS13230 (L2I54_13190) | - | 2586727..2587680 (-) | 954 | WP_256627413.1 | complement C1q tumor necrosis factor-related protein | - |
| L2I54_RS13235 (L2I54_13195) | - | 2587932..2588309 (-) | 378 | WP_061457241.1 | YxeA family protein | - |
| L2I54_RS13240 (L2I54_13200) | - | 2588895..2589269 (+) | 375 | WP_061457242.1 | hypothetical protein | - |
| L2I54_RS13245 (L2I54_13205) | - | 2589407..2589658 (-) | 252 | WP_061457243.1 | hypothetical protein | - |
| L2I54_RS13250 (L2I54_13210) | - | 2590114..2590392 (+) | 279 | WP_061457244.1 | hypothetical protein | - |
| L2I54_RS13255 (L2I54_13215) | - | 2590424..2590624 (+) | 201 | WP_061457245.1 | hypothetical protein | - |
| L2I54_RS13260 (L2I54_13220) | - | 2591163..2591333 (+) | 171 | WP_080446963.1 | hypothetical protein | - |
| L2I54_RS13265 (L2I54_13225) | - | 2591361..2591843 (+) | 483 | WP_061457246.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| L2I54_RS13270 (L2I54_13230) | - | 2591843..2592385 (+) | 543 | WP_061457247.1 | site-specific integrase | - |
| L2I54_RS13275 (L2I54_13235) | - | 2592638..2593630 (+) | 993 | WP_061457248.1 | tail fiber domain-containing protein | - |
| L2I54_RS13280 (L2I54_13240) | - | 2594000..2594953 (+) | 954 | WP_061457249.1 | hypothetical protein | - |
| L2I54_RS13285 (L2I54_13245) | - | 2595310..2595810 (+) | 501 | WP_061457250.1 | hypothetical protein | - |
| L2I54_RS13290 (L2I54_13250) | - | 2596009..2596221 (+) | 213 | WP_061457251.1 | hypothetical protein | - |
| L2I54_RS13295 (L2I54_13255) | - | 2596357..2596620 (+) | 264 | WP_061457252.1 | hypothetical protein | - |
| L2I54_RS13300 (L2I54_13260) | - | 2596607..2596942 (+) | 336 | WP_061457253.1 | HNH endonuclease | - |
| L2I54_RS13305 (L2I54_13265) | - | 2597093..2597449 (+) | 357 | WP_000763336.1 | hypothetical protein | - |
| L2I54_RS13310 (L2I54_13270) | - | 2597446..2599101 (+) | 1656 | WP_256627414.1 | terminase TerL endonuclease subunit | - |
| L2I54_RS13315 (L2I54_13275) | - | 2599167..2600273 (+) | 1107 | WP_061457273.1 | phage portal protein | - |
| L2I54_RS13320 (L2I54_13280) | - | 2600257..2601045 (+) | 789 | WP_061457254.1 | head maturation protease, ClpP-related | - |
| L2I54_RS13325 (L2I54_13285) | - | 2601049..2602203 (+) | 1155 | WP_061457255.1 | phage major capsid protein | - |
| L2I54_RS13330 (L2I54_13290) | - | 2602209..2602502 (+) | 294 | WP_061457256.1 | hypothetical protein | - |
| L2I54_RS13335 (L2I54_13295) | - | 2602504..2602857 (+) | 354 | WP_061457257.1 | phage head closure protein | - |
| L2I54_RS13340 (L2I54_13300) | - | 2602859..2603200 (+) | 342 | WP_061457258.1 | HK97 gp10 family phage protein | - |
| L2I54_RS13345 (L2I54_13305) | - | 2603200..2603529 (+) | 330 | WP_061457259.1 | hypothetical protein | - |
| L2I54_RS13350 (L2I54_13310) | - | 2603530..2604123 (+) | 594 | WP_001114731.1 | major tail protein | - |
| L2I54_RS13355 (L2I54_13315) | - | 2604130..2604486 (+) | 357 | WP_086386856.1 | hypothetical protein | - |
| L2I54_RS13360 (L2I54_13320) | - | 2604513..2604701 (+) | 189 | WP_235598835.1 | hypothetical protein | - |
| L2I54_RS13365 (L2I54_13325) | - | 2604717..2605925 (+) | 1209 | Protein_2562 | hypothetical protein | - |
| L2I54_RS13370 (L2I54_13330) | - | 2606183..2606440 (+) | 258 | WP_061457262.1 | hypothetical protein | - |
| L2I54_RS13375 (L2I54_13335) | - | 2606664..2608853 (+) | 2190 | WP_061457263.1 | hypothetical protein | - |
| L2I54_RS13380 (L2I54_13340) | - | 2608895..2610370 (+) | 1476 | WP_061457264.1 | distal tail protein Dit | - |
| L2I54_RS13385 (L2I54_13345) | - | 2610367..2615274 (+) | 4908 | WP_061457265.1 | phage tail spike protein | - |
| L2I54_RS13390 (L2I54_13350) | - | 2615312..2615548 (+) | 237 | WP_061457266.1 | hemolysin XhlA family protein | - |
| L2I54_RS13395 (L2I54_13355) | - | 2615548..2615787 (+) | 240 | WP_061457267.1 | hypothetical protein | - |
| L2I54_RS13400 (L2I54_13360) | - | 2615784..2616848 (+) | 1065 | WP_061457268.1 | N-acetylmuramoyl-L-alanine amidase | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10128.69 Da Isoelectric Point: 5.1584
>NTDB_id=651591 L2I54_RS13205 WP_061457236.1 2585012..2585290(+) (abrB) [Bacillus cereus strain GSICC 30237]
MKNTGIARKVDELGRVVIPVELRRTLGIAEGTSLDFHVDGENIVLRKQEKSCFVTGNVSESNMELLDGRMFLSKEGAIEL
LDILEKSGMAHA
MKNTGIARKVDELGRVVIPVELRRTLGIAEGTSLDFHVDGENIVLRKQEKSCFVTGNVSESNMELLDGRMFLSKEGAIEL
LDILEKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=651591 L2I54_RS13205 WP_061457236.1 2585012..2585290(+) (abrB) [Bacillus cereus strain GSICC 30237]
ATGAAAAATACAGGCATTGCAAGAAAAGTAGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAACATCACTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACAAGAAAAGTCCTGCTTTG
TAACAGGTAATGTTTCTGAATCGAACATGGAATTGTTGGACGGACGAATGTTTTTAAGTAAGGAAGGAGCCATTGAATTA
CTAGACATTCTTGAAAAGAGTGGGATGGCACATGCCTAA
ATGAAAAATACAGGCATTGCAAGAAAAGTAGACGAGCTAGGTCGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGCTGAAGGAACATCACTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACAAGAAAAGTCCTGCTTTG
TAACAGGTAATGTTTCTGAATCGAACATGGAATTGTTGGACGGACGAATGTTTTTAAGTAAGGAAGGAGCCATTGAATTA
CTAGACATTCTTGAAAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
59.036 |
90.217 |
0.533 |