Detailed information    

insolico Bioinformatically predicted

Overview


Name   dinR/lexA   Type   Regulator
Locus tag   OG959_RS09890 Genome accession   NZ_CP107951
Coordinates   2262781..2262999 (-) Length   72 a.a.
NCBI ID   WP_148020862.1    Uniprot ID   -
Organism   Streptomyces sp. NBC_00385     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context


Location: 2257781..2267999
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OG959_RS09850 (OG959_09860) - 2258012..2258833 (+) 822 WP_148020870.1 hypothetical protein -
  OG959_RS09855 (OG959_09865) - 2258858..2259700 (+) 843 WP_148020869.1 winged helix-turn-helix transcriptional regulator -
  OG959_RS09860 (OG959_09870) - 2260356..2260622 (-) 267 WP_148020868.1 hypothetical protein -
  OG959_RS09865 (OG959_09875) - 2260841..2261182 (+) 342 WP_148020867.1 DUF317 domain-containing protein -
  OG959_RS09870 (OG959_09880) - 2261250..2261471 (+) 222 WP_148020866.1 hypothetical protein -
  OG959_RS09875 (OG959_09885) - 2261559..2261771 (+) 213 WP_148020865.1 hypothetical protein -
  OG959_RS09880 (OG959_09890) - 2261862..2262188 (+) 327 WP_148020864.1 esterase -
  OG959_RS09885 (OG959_09895) - 2262490..2262660 (+) 171 WP_326657800.1 hypothetical protein -
  OG959_RS09890 (OG959_09900) dinR/lexA 2262781..2262999 (-) 219 WP_148020862.1 MarR family transcriptional regulator Regulator
  OG959_RS09895 (OG959_09905) - 2262996..2263238 (-) 243 WP_148020861.1 hypothetical protein -
  OG959_RS09900 - 2263368..2263781 (-) 414 WP_326657801.1 transposase -
  OG959_RS09905 - 2263967..2264155 (-) 189 WP_326657802.1 transposase family protein -
  OG959_RS09910 (OG959_09915) - 2264416..2264862 (-) 447 WP_148020860.1 GNAT family N-acetyltransferase -
  OG959_RS09915 (OG959_09920) - 2265027..2265431 (-) 405 WP_326657803.1 hypothetical protein -
  OG959_RS09920 (OG959_09925) - 2265529..2267298 (-) 1770 WP_148020858.1 relaxase/mobilization nuclease domain-containing protein -
  OG959_RS09925 (OG959_09930) mobC 2267298..2267963 (-) 666 WP_148020857.1 plasmid mobilization relaxosome protein MobC -

Sequence


Protein


Download         Length: 72 a.a.        Molecular weight: 8049.19 Da        Isoelectric Point: 11.8515

>NTDB_id=650071 OG959_RS09890 WP_148020862.1 2262781..2262999(-) (dinR/lexA) [Streptomyces sp. NBC_00385]
MSVDVPTDRQVQILRVIRNWIADHGEGPSIRQIGERVGLSSSSSVAYQLGRLETLGLISRTGRRWRSCRLGT

Nucleotide


Download         Length: 219 bp        

>NTDB_id=650071 OG959_RS09890 WP_148020862.1 2262781..2262999(-) (dinR/lexA) [Streptomyces sp. NBC_00385]
ATGAGTGTCGACGTCCCGACCGATCGGCAGGTCCAGATTCTGCGGGTGATCAGGAACTGGATCGCGGATCACGGCGAGGG
GCCCTCGATCCGTCAGATCGGAGAGCGAGTCGGCCTGTCCAGCAGCAGCTCGGTCGCCTACCAACTCGGGCGCCTGGAAA
CCCTGGGACTGATCAGTCGCACGGGGCGGCGCTGGCGCTCCTGCCGGCTTGGCACCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

48.387

86.111

0.417