Detailed information
Bioinformatically predicted
Overview
| Name | HI0659 | Type | Machinery gene |
| Locus tag | H020_RS0105670 | Genome accession | NZ_AKVY01000001 |
| Coordinates | 1073569..1073862 (+) | Length | 97 a.a. |
| NCBI ID | WP_000794247.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | DNA uptake (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1065160..1085702 | 1073569..1073862 | within | 0 |
Gene organization within MGE regions
Location: 1065160..1085702
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H020_RS0105600 | - | 1065160..1066323 (-) | 1164 | WP_001021837.1 | tyrosine-type recombinase/integrase | - |
| H020_RS0105605 | - | 1066398..1067246 (-) | 849 | WP_000700645.1 | helix-turn-helix domain-containing protein | - |
| H020_RS14665 | - | 1067366..1067719 (+) | 354 | WP_000032304.1 | helix-turn-helix transcriptional regulator | - |
| H020_RS0105615 | - | 1067819..1068085 (+) | 267 | WP_000404762.1 | hypothetical protein | - |
| H020_RS13975 | - | 1068096..1068248 (+) | 153 | WP_000706985.1 | hypothetical protein | - |
| H020_RS0105625 | - | 1068453..1069070 (+) | 618 | WP_000424676.1 | Rha family transcriptional regulator | - |
| H020_RS0105630 | - | 1069105..1069557 (+) | 453 | WP_000141102.1 | hypothetical protein | - |
| H020_RS0105635 | - | 1069554..1070000 (+) | 447 | WP_000171242.1 | DnaD domain protein | - |
| H020_RS0105640 | - | 1070012..1070896 (+) | 885 | WP_000838905.1 | ATP-binding protein | - |
| H020_RS0105645 | - | 1071145..1071795 (+) | 651 | WP_000138311.1 | hypothetical protein | - |
| H020_RS0105650 | - | 1071842..1072270 (+) | 429 | WP_000918210.1 | hypothetical protein | - |
| H020_RS0105655 | - | 1072278..1072589 (+) | 312 | WP_001113833.1 | hypothetical protein | - |
| H020_RS0105660 | - | 1072607..1073017 (+) | 411 | WP_000162610.1 | hypothetical protein | - |
| H020_RS0105665 | - | 1073214..1073579 (+) | 366 | WP_000551587.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| H020_RS0105670 | HI0659 | 1073569..1073862 (+) | 294 | WP_000794247.1 | helix-turn-helix domain-containing protein | Machinery gene |
| H020_RS0105675 | - | 1073880..1075070 (+) | 1191 | WP_000123149.1 | hypothetical protein | - |
| H020_RS13980 | - | 1075073..1075249 (+) | 177 | WP_000346914.1 | hypothetical protein | - |
| H020_RS12795 | - | 1075569..1076015 (-) | 447 | WP_061631657.1 | tyrosine-type recombinase/integrase | - |
| H020_RS12800 | - | 1075915..1076760 (-) | 846 | Protein_1081 | IS630 family transposase | - |
| H020_RS13455 | - | 1076931..1077086 (+) | 156 | Protein_1082 | diacylglycerol kinase family lipid kinase | - |
| H020_RS0105695 | rexB | 1077286..1080561 (+) | 3276 | WP_000772372.1 | ATP-dependent nuclease subunit B | - |
| H020_RS0105700 | addA | 1080558..1084208 (+) | 3651 | WP_000767212.1 | helicase-exonuclease AddAB subunit AddA | - |
| H020_RS0105705 | - | 1084423..1085601 (+) | 1179 | WP_000174755.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 97 a.a. Molecular weight: 10751.45 Da Isoelectric Point: 5.1991
>NTDB_id=64930 H020_RS0105670 WP_000794247.1 1073569..1073862(+) (HI0659) [Streptococcus pneumoniae TIGR4]
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQV
MKNNAIGSNWKDVRAELFSKEEILESDMRVAIMSELIEARNEKGISQKKLEEMSGVSQPVIARMETGKTSPQLDTVLKVL
ASLGKTLAVVPLEHEQV
Nucleotide
Download Length: 294 bp
>NTDB_id=64930 H020_RS0105670 WP_000794247.1 1073569..1073862(+) (HI0659) [Streptococcus pneumoniae TIGR4]
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAGGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGAAATGAAAAGGGTATTAGTCAGAAGAAACTAGAGGAGATGA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCACAACTTGATACAGTATTAAAAGTGTTG
GCAAGTCTTGGTAAGACCTTAGCTGTTGTACCATTAGAGCATGAGCAGGTTTAG
ATGAAAAATAATGCTATTGGTAGTAACTGGAAAGATGTAAGAGCTGAATTATTCAGCAAAGAGGAAATTTTGGAAAGTGA
TATGCGCGTGGCTATCATGAGTGAGCTTATCGAGGCTAGAAATGAAAAGGGTATTAGTCAGAAGAAACTAGAGGAGATGA
GCGGTGTTAGTCAGCCAGTTATCGCTAGAATGGAAACAGGAAAGACAAGCCCACAACTTGATACAGTATTAAAAGTGTTG
GCAAGTCTTGGTAAGACCTTAGCTGTTGTACCATTAGAGCATGAGCAGGTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| HI0659 | Haemophilus influenzae Rd KW20 |
57.143 |
93.814 |
0.536 |