Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   L3C11_RS15515 Genome accession   NZ_CP091288
Coordinates   3016356..3016529 (-) Length   57 a.a.
NCBI ID   WP_032874029.1    Uniprot ID   -
Organism   Bacillus velezensis strain JJ47     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3011356..3021529
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L3C11_RS15465 (L3C11_15465) comGD 3011475..3011912 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  L3C11_RS15470 (L3C11_15470) comGE 3011896..3012210 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  L3C11_RS15475 (L3C11_15475) comGF 3012119..3012619 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  L3C11_RS15480 (L3C11_15480) comGG 3012620..3012997 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  L3C11_RS15485 (L3C11_15485) - 3013054..3013233 (+) 180 WP_022552966.1 YqzE family protein -
  L3C11_RS15490 (L3C11_15490) - 3013274..3013603 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  L3C11_RS15495 (L3C11_15495) tapA 3013862..3014533 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  L3C11_RS15500 (L3C11_15500) sipW 3014505..3015089 (+) 585 WP_032874025.1 signal peptidase I SipW -
  L3C11_RS15505 (L3C11_15505) tasA 3015154..3015939 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  L3C11_RS15510 (L3C11_15510) sinR 3015987..3016322 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  L3C11_RS15515 (L3C11_15515) sinI 3016356..3016529 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  L3C11_RS15520 (L3C11_15520) - 3016706..3017500 (-) 795 WP_007612541.1 YqhG family protein -
  L3C11_RS15525 (L3C11_15525) - 3017522..3019192 (-) 1671 WP_032874031.1 DEAD/DEAH box helicase -
  L3C11_RS15530 (L3C11_15530) gcvT 3019615..3020715 (+) 1101 WP_032874033.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6658.66 Da        Isoelectric Point: 9.8168

>NTDB_id=648930 L3C11_RS15515 WP_032874029.1 3016356..3016529(-) (sinI) [Bacillus velezensis strain JJ47]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=648930 L3C11_RS15515 WP_032874029.1 3016356..3016529(-) (sinI) [Bacillus velezensis strain JJ47]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719