Detailed information    

insolico Bioinformatically predicted

Overview


Name   dinR/lexA   Type   Regulator
Locus tag   OG803_RS36815 Genome accession   NZ_CP107894
Coordinates   8108028..8108240 (-) Length   70 a.a.
NCBI ID   WP_327687012.1    Uniprot ID   -
Organism   Streptomyces sp. NBC_00467     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context


Location: 8103028..8113240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OG803_RS36785 (OG803_36835) - 8103898..8104146 (+) 249 WP_327686416.1 hypothetical protein -
  OG803_RS36790 (OG803_36840) - 8104535..8105626 (+) 1092 Protein_7267 IS30 family transposase -
  OG803_RS36795 (OG803_36845) - 8105876..8106934 (+) 1059 WP_327677226.1 IS110 family transposase -
  OG803_RS36800 (OG803_36850) - 8106941..8107111 (+) 171 Protein_7269 IS30 family transposase -
  OG803_RS36805 (OG803_36855) - 8107344..8107583 (+) 240 WP_327686417.1 hypothetical protein -
  OG803_RS36810 (OG803_36860) - 8107840..8107989 (+) 150 WP_327686418.1 hypothetical protein -
  OG803_RS36815 (OG803_36865) dinR/lexA 8108028..8108240 (-) 213 WP_327687012.1 winged helix DNA-binding protein Regulator
  OG803_RS36820 (OG803_36870) - 8108453..8108683 (+) 231 WP_313941962.1 DUF5133 domain-containing protein -
  OG803_RS36825 (OG803_36875) - 8109174..8109581 (+) 408 WP_327686419.1 ANTAR domain-containing protein -
  OG803_RS36830 (OG803_36880) - 8110161..8110499 (+) 339 WP_327686420.1 hypothetical protein -
  OG803_RS36835 (OG803_36885) - 8110643..8111317 (+) 675 WP_327686421.1 DUF6766 family protein -
  OG803_RS36840 (OG803_36890) - 8111345..8111704 (-) 360 WP_327686422.1 STAS domain-containing protein -
  OG803_RS36845 (OG803_36895) - 8111819..8112361 (-) 543 WP_327686423.1 isochorismatase family cysteine hydrolase -
  OG803_RS36850 (OG803_36900) - 8112636..8112962 (+) 327 WP_327686424.1 plasmid stabilization protein -

Sequence


Protein


Download         Length: 70 a.a.        Molecular weight: 7630.60 Da        Isoelectric Point: 9.3194

>NTDB_id=648230 OG803_RS36815 WP_327687012.1 8108028..8108240(-) (dinR/lexA) [Streptomyces sp. NBC_00467]
MDHLSARQERILGCIRERIAETGEGPSIRQIGQVVGLSSTSSVAYQLGRLEESGLISRSTSSWRSVRLGT

Nucleotide


Download         Length: 213 bp        

>NTDB_id=648230 OG803_RS36815 WP_327687012.1 8108028..8108240(-) (dinR/lexA) [Streptomyces sp. NBC_00467]
ATGGATCACCTGAGCGCGCGGCAGGAGCGGATCCTCGGCTGCATCCGCGAGCGGATCGCCGAGACCGGCGAGGGACCGAG
CATCCGGCAGATCGGACAGGTCGTGGGCCTGTCGTCCACGTCATCCGTGGCCTACCAGCTCGGACGGCTCGAAGAGTCCG
GGCTGATCAGCCGCAGCACCAGCAGCTGGCGCTCGGTCCGCCTCGGCACCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

42.647

97.143

0.414