Detailed information    

insolico Bioinformatically predicted

Overview

Name   sxy/tfoX   Type   Regulator
Locus tag   L1O95_RS16710 Genome accession   NZ_CP091020
Coordinates   3266492..3267121 (-) Length   209 a.a.
NCBI ID   WP_000839153.1    Uniprot ID   A0A9Q6Y251
Organism   Escherichia coli strain STEC308     
Function   positive regulator of competence gene (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 3237189..3289001 3266492..3267121 within 0


Gene organization within MGE regions


Location: 3237189..3289001
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L1O95_RS16485 - 3237338..3237607 (+) 270 WP_000159741.1 hypothetical protein -
  L1O95_RS26315 - 3237588..3237713 (-) 126 WP_001372763.1 hypothetical protein -
  L1O95_RS16490 - 3237740..3238117 (-) 378 WP_000014554.1 M15 family metallopeptidase -
  L1O95_RS16495 - 3238126..3238395 (-) 270 WP_033813144.1 phage holin family protein -
  L1O95_RS16500 - 3238385..3238777 (-) 393 WP_162215615.1 putative holin -
  L1O95_RS16505 - 3238870..3239172 (-) 303 WP_235384690.1 DNA-methyltransferase -
  L1O95_RS16510 - 3239153..3239902 (-) 750 WP_235384691.1 DNA methyltransferase -
  L1O95_RS16515 - 3239903..3240646 (-) 744 WP_235384692.1 helix-turn-helix domain-containing protein -
  L1O95_RS16520 - 3240873..3241694 (-) 822 WP_033812998.1 antitermination protein -
  L1O95_RS16525 - 3241691..3242065 (-) 375 WP_033812997.1 RusA family crossover junction endodeoxyribonuclease -
  L1O95_RS16530 - 3242078..3243127 (-) 1050 WP_033812996.1 DUF968 domain-containing protein -
  L1O95_RS16535 - 3243129..3243407 (-) 279 WP_033812995.1 hypothetical protein -
  L1O95_RS16540 - 3243474..3243641 (-) 168 WP_199913593.1 hypothetical protein -
  L1O95_RS16545 hokD 3244021..3244176 (-) 156 WP_000813255.1 type I toxin-antitoxin system toxin HokD -
  L1O95_RS16550 - 3244448..3244843 (-) 396 WP_033812992.1 hypothetical protein -
  L1O95_RS16555 - 3244843..3245376 (-) 534 WP_033812991.1 DUF551 domain-containing protein -
  L1O95_RS16560 - 3245378..3245596 (-) 219 WP_033558349.1 DUF4014 family protein -
  L1O95_RS16565 - 3245724..3246035 (-) 312 WP_033812990.1 hypothetical protein -
  L1O95_RS16570 - 3246028..3246282 (-) 255 WP_202851355.1 hypothetical protein -
  L1O95_RS16575 - 3246279..3246701 (-) 423 WP_146313799.1 DUF977 family protein -
  L1O95_RS16580 - 3246718..3247488 (-) 771 WP_033812988.1 DUF1627 domain-containing protein -
  L1O95_RS16585 - 3247523..3247984 (-) 462 WP_231245319.1 replication protein P -
  L1O95_RS16590 - 3247977..3249016 (-) 1040 Protein_3269 DnaT-like ssDNA-binding domain-containing protein -
  L1O95_RS16595 - 3249088..3249513 (-) 426 WP_033812986.1 toxin YdaT family protein -
  L1O95_RS16600 - 3249497..3249772 (-) 276 WP_001585828.1 transcriptional regulator -
  L1O95_RS16605 - 3249882..3250265 (+) 384 WP_225390879.1 helix-turn-helix domain-containing protein -
  L1O95_RS16610 - 3250435..3250590 (+) 156 WP_000379577.1 DUF1391 family protein -
  L1O95_RS26320 ydfB 3250592..3250720 (+) 129 WP_074154819.1 protein YdfB -
  L1O95_RS16615 ydfC 3250751..3250969 (+) 219 WP_001171946.1 protein YdfC -
  L1O95_RS16620 - 3250992..3251399 (+) 408 WP_033812984.1 hypothetical protein -
  L1O95_RS16625 - 3251377..3251610 (-) 234 WP_000920491.1 hypothetical protein -
  L1O95_RS16630 dicB 3252178..3252360 (+) 183 WP_000449182.1 cell division inhibition protein DicB -
  L1O95_RS16635 - 3252363..3252566 (+) 204 WP_001098749.1 DUF1482 family protein -
  L1O95_RS16640 - 3252647..3255127 (+) 2481 WP_231257687.1 exonuclease -
  L1O95_RS16645 - 3255194..3255445 (+) 252 WP_033813308.1 DUF4224 domain-containing protein -
  L1O95_RS16650 - 3255414..3256433 (+) 1020 WP_001364438.1 tyrosine-type recombinase/integrase -
  L1O95_RS16655 yccA 3256841..3257500 (+) 660 WP_000375136.1 FtsH protease modulator YccA -
  L1O95_RS16660 tusE 3257591..3257920 (+) 330 WP_000904442.1 sulfurtransferase TusE -
  L1O95_RS16665 yccX 3257917..3258195 (-) 279 WP_000048250.1 acylphosphatase -
  L1O95_RS16670 rlmI 3258290..3259480 (+) 1191 WP_000116288.1 23S rRNA (cytosine(1962)-C(5))-methyltransferase RlmI -
  L1O95_RS16675 hspQ 3259538..3259855 (+) 318 WP_001295356.1 heat shock protein HspQ -
  L1O95_RS16680 yccU 3259900..3260313 (-) 414 WP_000665217.1 CoA-binding protein -
  L1O95_RS16685 csgI 3260486..3261148 (+) 663 WP_000847791.1 DUF2057 family protein -
  L1O95_RS16690 mgsA 3261244..3261702 (+) 459 WP_000424181.1 methylglyoxal synthase -
  L1O95_RS16695 helD 3261734..3263788 (-) 2055 WP_000420536.1 DNA helicase IV -
  L1O95_RS16700 yccF 3263911..3264357 (+) 447 WP_001261235.1 YccF domain-containing protein -
  L1O95_RS16705 yccS 3264367..3266529 (+) 2163 WP_000875023.1 YccS family putative transporter -
  L1O95_RS16710 sxy/tfoX 3266492..3267121 (-) 630 WP_000839153.1 CRP-S regulon transcriptional coactivator Sxy Regulator
  L1O95_RS16715 sulA 3267340..3267849 (+) 510 WP_000288710.1 SOS-induced cell division inhibitor SulA -
  L1O95_RS16720 ompA 3268206..3269258 (+) 1053 WP_001361736.1 porin OmpA -
  L1O95_RS16725 matP 3269334..3269786 (-) 453 WP_000877161.1 macrodomain Ter protein MatP -
  L1O95_RS16730 ycbZ 3269972..3271732 (+) 1761 WP_000156526.1 AAA family ATPase -
  L1O95_RS16735 fabA 3271801..3272319 (+) 519 WP_000227927.1 bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase -
  L1O95_RS16740 rmf 3272389..3272556 (-) 168 WP_000828648.1 ribosome modulation factor -
  L1O95_RS16745 pqiC 3272812..3273375 (-) 564 WP_000759120.1 membrane integrity-associated transporter subunit PqiC -
  L1O95_RS16750 pqiB 3273372..3275012 (-) 1641 WP_000445535.1 intermembrane transport protein PqiB -
  L1O95_RS16755 pqiA 3275017..3276270 (-) 1254 WP_000333176.1 membrane integrity-associated transporter subunit PqiA -
  L1O95_RS16760 uup 3276400..3278307 (-) 1908 WP_000053069.1 ABC transporter ATP-binding protein -
  L1O95_RS16765 rlmKL 3278319..3280427 (-) 2109 WP_001086520.1 bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL -
  L1O95_RS16770 ycbX 3280671..3281780 (+) 1110 WP_000224270.1 6-N-hydroxylaminopurine resistance protein YcbX -
  L1O95_RS16775 zapC 3281777..3282319 (-) 543 WP_001356205.1 cell division protein ZapC -
  L1O95_RS16780 pyrD 3282493..3283503 (-) 1011 WP_001295352.1 quinone-dependent dihydroorotate dehydrogenase -
  L1O95_RS16785 ycbF 3283614..3284351 (-) 738 WP_001111449.1 fimbrial chaperone -
  L1O95_RS16790 ycbV 3284317..3284832 (-) 516 WP_000919480.1 fimbrial protein -
  L1O95_RS16795 ycbU 3284840..3285382 (-) 543 WP_000730614.1 fimbrial protein -
  L1O95_RS16800 elfG 3285394..3286464 (-) 1071 WP_001165655.1 fimbrial protein -

Sequence

Protein


Download         Length: 209 a.a.        Molecular weight: 24147.02 Da        Isoelectric Point: 9.2180

>NTDB_id=647190 L1O95_RS16710 WP_000839153.1 3266492..3267121(-) (sxy/tfoX) [Escherichia coli strain STEC308]
MKSLSYKRIYKSQEYLATLGTIEYRSLFGSYSLTVDDTVFAMVSDGELYLRACEQSAQYCVKHPPVWLTYKKCGRSVTLN
YYRVDESLWRNQLKLVRLSKYSLDAALKEKSTRNTRERLKDLPNMSFHLEAILGEVGIKDVRALRILGAKMCWLRLRQQN
SLVTEKILFMLEGAIIGIHEAALPVARRQELAEWADSLTPKQEFPAELE

Nucleotide


Download         Length: 630 bp        

>NTDB_id=647190 L1O95_RS16710 WP_000839153.1 3266492..3267121(-) (sxy/tfoX) [Escherichia coli strain STEC308]
ATGAAAAGCCTCTCCTATAAGCGGATCTATAAATCACAAGAATACCTGGCAACGTTGGGCACAATTGAATACCGATCATT
GTTTGGCAGTTACAGCCTGACCGTTGACGACACGGTGTTTGCGATGGTTTCTGATGGTGAGTTGTATCTTCGGGCTTGTG
AGCAAAGTGCACAGTACTGTGTAAAACATCCGCCTGTCTGGCTGACATATAAAAAGTGTGGCCGATCCGTTACCCTCAAT
TACTATCGGGTTGATGAAAGTCTATGGCGAAATCAACTGAAGCTGGTGCGTCTGTCGAAATATTCTCTCGATGCAGCGCT
GAAAGAGAAAAGCACGCGCAATACCCGGGAAAGACTGAAAGATTTGCCCAATATGTCTTTTCATCTGGAAGCGATTCTCG
GGGAGGTGGGGATTAAGGATGTACGGGCGTTACGTATACTTGGGGCAAAAATGTGTTGGTTGCGACTGCGGCAGCAAAAC
AGTCTGGTGACAGAAAAGATTCTGTTTATGCTTGAAGGTGCCATTATCGGCATTCATGAAGCTGCGCTCCCGGTGGCACG
CCGCCAGGAGCTTGCAGAATGGGCTGACTCTCTTACGCCGAAACAGGAGTTTCCTGCGGAACTTGAGTAA

Domains

Predicted by InterproScan.

TfoX N-terminal domain (TfoX_N)

(14-106)

TfoX C-terminal domain (TfoX_C)

(116-194)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sxy/tfoX Escherichia coli BW25113 strain K-12

100

100

1