Detailed information    

insolico Bioinformatically predicted

Overview

Name   dinR/lexA   Type   Regulator
Locus tag   OHP34_RS10065 Genome accession   NZ_CP107861
Coordinates   2218834..2219049 (-) Length   71 a.a.
NCBI ID   WP_327660440.1    Uniprot ID   -
Organism   Streptomyces sp. NBC_00499     
Function   repressor of recA; repressor of dinR (predicted from homology)   
Homologous recombination

Genomic Context

Location: 2213834..2224049
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OHP34_RS10010 (OHP34_10035) - 2214271..2214813 (-) 543 WP_327660429.1 major capsid protein -
  OHP34_RS10015 (OHP34_10040) - 2214829..2215239 (-) 411 WP_327660430.1 head decoration protein -
  OHP34_RS10020 (OHP34_10045) - 2215541..2216056 (-) 516 WP_327660431.1 hypothetical protein -
  OHP34_RS10025 (OHP34_10050) - 2216121..2216870 (+) 750 WP_327660432.1 TIGR02391 family protein -
  OHP34_RS10030 (OHP34_10055) - 2217119..2217316 (-) 198 WP_327660433.1 hypothetical protein -
  OHP34_RS10035 (OHP34_10060) - 2217309..2217515 (-) 207 WP_327660434.1 hypothetical protein -
  OHP34_RS10040 (OHP34_10065) - 2217512..2217721 (-) 210 WP_327660435.1 hypothetical protein -
  OHP34_RS10045 (OHP34_10070) - 2217718..2217963 (-) 246 WP_327660436.1 hypothetical protein -
  OHP34_RS10050 (OHP34_10075) - 2217960..2218085 (-) 126 WP_327660437.1 hypothetical protein -
  OHP34_RS10055 (OHP34_10080) - 2218082..2218450 (-) 369 WP_327660438.1 hypothetical protein -
  OHP34_RS10060 (OHP34_10085) - 2218613..2218837 (-) 225 WP_327660439.1 hypothetical protein -
  OHP34_RS10065 (OHP34_10090) dinR/lexA 2218834..2219049 (-) 216 WP_327660440.1 MarR family transcriptional regulator Regulator
  OHP34_RS10070 (OHP34_10095) - 2219120..2219485 (-) 366 WP_327660441.1 hypothetical protein -
  OHP34_RS10075 (OHP34_10100) - 2219834..2220166 (-) 333 WP_327660442.1 hypothetical protein -
  OHP34_RS10080 (OHP34_10105) - 2220274..2220489 (+) 216 WP_327660443.1 hypothetical protein -
  OHP34_RS10085 (OHP34_10110) - 2220818..2221621 (-) 804 WP_327660444.1 hypothetical protein -
  OHP34_RS10090 (OHP34_10115) - 2221631..2222116 (-) 486 WP_327660445.1 hypothetical protein -
  OHP34_RS10095 (OHP34_10120) - 2222113..2222802 (-) 690 WP_327660446.1 hypothetical protein -
  OHP34_RS10100 (OHP34_10125) - 2222971..2223723 (-) 753 WP_327660317.1 transposase family protein -

Sequence

Protein


Download         Length: 71 a.a.        Molecular weight: 8077.39 Da        Isoelectric Point: 12.0968

>NTDB_id=647141 OHP34_RS10065 WP_327660440.1 2218834..2219049(-) (dinR/lexA) [Streptomyces sp. NBC_00499]
MSMGITDRQRQILRAIKEHVAETGDYPSMAQLARRAGLSSASSVHYQLGRLEQLGVITRQRRKFRAPIRVL

Nucleotide


Download         Length: 216 bp        

>NTDB_id=647141 OHP34_RS10065 WP_327660440.1 2218834..2219049(-) (dinR/lexA) [Streptomyces sp. NBC_00499]
ATGAGCATGGGCATCACGGACCGGCAGCGCCAGATCCTGCGCGCCATCAAGGAGCACGTTGCGGAGACCGGCGACTACCC
GAGCATGGCGCAACTGGCACGGCGAGCCGGACTCTCCAGCGCCTCCAGCGTCCACTATCAGTTGGGGCGACTCGAACAGC
TCGGCGTGATCACCAGGCAGCGCCGCAAGTTCCGCGCGCCCATCAGAGTGCTGTGA

Domains

Predicted by InterProScan.

LexA DNA binding domain (LexA_DNA_bind)

(4-66)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dinR/lexA Bacillus subtilis subsp. subtilis str. 168

43.548

87.324

0.38