Detailed information
Bioinformatically predicted
Overview
| Name | comGG | Type | Machinery gene |
| Locus tag | LL229_RS11955 | Genome accession | NZ_CP090823 |
| Coordinates | 2291865..2292149 (-) | Length | 94 a.a. |
| NCBI ID | WP_010906314.1 | Uniprot ID | A0AAC9R304 |
| Organism | Lactococcus lactis subsp. lactis strain 229 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2260827..2314886 | 2291865..2292149 | within | 0 |
Gene organization within MGE regions
Location: 2260827..2314886
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL229_RS11730 (LL229_2230) | rpsK | 2261381..2261764 (-) | 384 | WP_010906297.1 | 30S ribosomal protein S11 | - |
| LL229_RS11735 (LL229_2231) | rpsM | 2261785..2262150 (-) | 366 | WP_003130555.1 | 30S ribosomal protein S13 | - |
| LL229_RS11740 (LL229_03410) | rpmJ | 2262168..2262284 (-) | 117 | WP_001808836.1 | 50S ribosomal protein L36 | - |
| LL229_RS11745 (LL229_2232) | infA | 2262338..2262556 (-) | 219 | WP_003130554.1 | translation initiation factor IF-1 | - |
| LL229_RS11750 (LL229_2234) | - | 2262922..2263730 (-) | 809 | Protein_2255 | IS3-like element ISLla3 family transposase | - |
| LL229_RS11755 (LL229_2235) | - | 2263807..2264454 (-) | 648 | WP_010906298.1 | adenylate kinase | - |
| LL229_RS11760 (LL229_2236) | secY | 2264594..2265913 (-) | 1320 | WP_003129919.1 | preprotein translocase subunit SecY | - |
| LL229_RS11765 (LL229_2237) | rplO | 2265991..2266434 (-) | 444 | WP_003129920.1 | 50S ribosomal protein L15 | - |
| LL229_RS11770 (LL229_2238) | rpmD | 2266709..2266888 (-) | 180 | WP_003129921.1 | 50S ribosomal protein L30 | - |
| LL229_RS11775 (LL229_2239) | rpsE | 2266899..2267405 (-) | 507 | WP_003129922.1 | 30S ribosomal protein S5 | - |
| LL229_RS11780 (LL229_2240) | rplR | 2267424..2267771 (-) | 348 | WP_003129924.1 | 50S ribosomal protein L18 | - |
| LL229_RS11785 (LL229_2241) | rplF | 2267987..2268523 (-) | 537 | WP_003129925.1 | 50S ribosomal protein L6 | - |
| LL229_RS11790 (LL229_2242) | rpsH | 2268740..2269138 (-) | 399 | WP_010906299.1 | 30S ribosomal protein S8 | - |
| LL229_RS11795 (LL229_2243) | - | 2269354..2269938 (-) | 585 | WP_010906300.1 | DUF6287 domain-containing protein | - |
| LL229_RS11800 (LL229_2244) | - | 2270089..2270274 (-) | 186 | WP_003129946.1 | type Z 30S ribosomal protein S14 | - |
| LL229_RS11805 (LL229_2245) | rplE | 2270293..2270835 (-) | 543 | WP_003129948.1 | 50S ribosomal protein L5 | - |
| LL229_RS11810 (LL229_2246) | rplX | 2270855..2271160 (-) | 306 | WP_003129951.1 | 50S ribosomal protein L24 | - |
| LL229_RS11815 (LL229_2247) | rplN | 2271294..2271662 (-) | 369 | WP_003129953.1 | 50S ribosomal protein L14 | - |
| LL229_RS11820 (LL229_2248) | rpsQ | 2271685..2271945 (-) | 261 | WP_003129955.1 | 30S ribosomal protein S17 | - |
| LL229_RS11825 (LL229_2249) | rpmC | 2271966..2272175 (-) | 210 | WP_003129957.1 | 50S ribosomal protein L29 | - |
| LL229_RS11830 (LL229_2250) | rplP | 2272175..2272588 (-) | 414 | WP_003129958.1 | 50S ribosomal protein L16 | - |
| LL229_RS11835 (LL229_2251) | rpsC | 2272592..2273245 (-) | 654 | WP_010906301.1 | 30S ribosomal protein S3 | - |
| LL229_RS11840 (LL229_2252) | rplV | 2273258..2273605 (-) | 348 | WP_010906302.1 | 50S ribosomal protein L22 | - |
| LL229_RS11845 (LL229_2253) | rpsS | 2273621..2273899 (-) | 279 | WP_003129963.1 | 30S ribosomal protein S19 | - |
| LL229_RS11850 (LL229_2254) | rplB | 2274059..2274889 (-) | 831 | WP_003129965.1 | 50S ribosomal protein L2 | - |
| LL229_RS11855 (LL229_2255) | - | 2274905..2275198 (-) | 294 | WP_003129966.1 | 50S ribosomal protein L23 | - |
| LL229_RS11860 (LL229_2256) | rplD | 2275198..2275824 (-) | 627 | WP_003129968.1 | 50S ribosomal protein L4 | - |
| LL229_RS11865 (LL229_2257) | rplC | 2275850..2276473 (-) | 624 | WP_003129970.1 | 50S ribosomal protein L3 | - |
| LL229_RS11870 (LL229_2258) | rpsJ | 2276492..2276800 (-) | 309 | WP_003129973.1 | 30S ribosomal protein S10 | - |
| LL229_RS11875 (LL229_2259) | mscL | 2277113..2277481 (+) | 369 | WP_010906303.1 | large-conductance mechanosensitive channel protein MscL | - |
| LL229_RS11880 (LL229_2260) | - | 2277521..2278810 (-) | 1290 | WP_021214884.1 | MATE family efflux transporter | - |
| LL229_RS11885 (LL229_2261) | thrC | 2278807..2280297 (-) | 1491 | WP_003129976.1 | threonine synthase | - |
| LL229_RS11890 (LL229_2262) | nusG | 2280399..2280956 (-) | 558 | WP_003129977.1 | transcription termination/antitermination protein NusG | - |
| LL229_RS11895 (LL229_2263) | secE | 2281154..2281348 (-) | 195 | WP_003129978.1 | preprotein translocase subunit SecE | - |
| LL229_RS11900 (LL229_03415) | rpmG | 2281459..2281608 (-) | 150 | WP_010906305.1 | 50S ribosomal protein L33 | - |
| LL229_RS11905 (LL229_2264) | - | 2281649..2283466 (-) | 1818 | WP_010906306.1 | acyltransferase family protein | - |
| LL229_RS11910 (LL229_2265) | - | 2283568..2285799 (-) | 2232 | WP_003129980.1 | PBP1A family penicillin-binding protein | - |
| LL229_RS11915 (LL229_2266) | - | 2286108..2286743 (-) | 636 | WP_010906307.1 | DUF421 domain-containing protein | - |
| LL229_RS11920 (LL229_2267) | - | 2286760..2287191 (-) | 432 | WP_010906308.1 | DUF3290 domain-containing protein | - |
| LL229_RS11925 (LL229_2268) | - | 2287305..2287682 (-) | 378 | WP_003129983.1 | pyridoxamine 5'-phosphate oxidase family protein | - |
| LL229_RS11930 (LL229_2269) | - | 2287887..2288753 (+) | 867 | WP_010906309.1 | RluA family pseudouridine synthase | - |
| LL229_RS11935 (LL229_2270) | - | 2288792..2289601 (-) | 810 | WP_010906310.1 | metal ABC transporter permease | - |
| LL229_RS11940 (LL229_2271) | - | 2289594..2290331 (-) | 738 | WP_010906311.1 | metal ABC transporter ATP-binding protein | - |
| LL229_RS11945 (LL229_2272) | - | 2290508..2291350 (-) | 843 | WP_010906312.1 | metal ABC transporter substrate-binding protein | - |
| LL229_RS11950 (LL229_2273) | - | 2291347..2291784 (-) | 438 | WP_010906313.1 | zinc-dependent MarR family transcriptional regulator | - |
| LL229_RS11955 (LL229_2274) | comGG | 2291865..2292149 (-) | 285 | WP_010906314.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LL229_RS11960 (LL229_2275) | comGF | 2292188..2292634 (-) | 447 | WP_031296844.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LL229_RS11965 (LL229_2276) | comGE | 2292597..2292893 (-) | 297 | WP_010906316.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LL229_RS11970 (LL229_2277) | comGD | 2292865..2293281 (-) | 417 | WP_021216554.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LL229_RS11975 (LL229_2278) | comGC | 2293256..2293525 (-) | 270 | WP_023349160.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LL229_RS11980 (LL229_2279) | - | 2293686..2294423 (-) | 738 | WP_081172231.1 | hypothetical protein | - |
| LL229_RS11985 (LL229_2281) | - | 2294627..2295406 (-) | 780 | WP_081172233.1 | peptidoglycan amidohydrolase family protein | - |
| LL229_RS11990 (LL229_2282) | - | 2295406..2295693 (-) | 288 | WP_010905390.1 | phage holin | - |
| LL229_RS11995 (LL229_03420) | - | 2295680..2296006 (-) | 327 | WP_010905389.1 | hypothetical protein | - |
| LL229_RS12000 (LL229_03425) | - | 2296026..2301407 (-) | 5382 | WP_317983295.1 | hypothetical protein | - |
| LL229_RS12005 (LL229_03430) | - | 2301385..2301558 (-) | 174 | WP_081172169.1 | hypothetical protein | - |
| LL229_RS12010 (LL229_03435) | - | 2301558..2302679 (-) | 1122 | WP_081172171.1 | hypothetical protein | - |
| LL229_RS12015 (LL229_03440) | - | 2302695..2304482 (-) | 1788 | WP_081172173.1 | phage tail protein | - |
| LL229_RS12020 (LL229_03445) | - | 2304482..2306017 (-) | 1536 | WP_081172175.1 | distal tail protein Dit | - |
| LL229_RS12025 (LL229_03450) | - | 2306020..2311149 (-) | 5130 | WP_081172177.1 | phage tail tape measure protein | - |
| LL229_RS12030 (LL229_03455) | - | 2311374..2311790 (-) | 417 | WP_021214451.1 | phage tail assembly chaperone | - |
| LL229_RS12035 (LL229_03460) | - | 2311935..2312528 (-) | 594 | WP_010905928.1 | phage tail protein | - |
| LL229_RS12040 (LL229_03465) | - | 2312559..2312954 (-) | 396 | WP_063280625.1 | DUF806 family protein | - |
| LL229_RS12045 (LL229_03470) | - | 2312951..2313457 (-) | 507 | WP_081172179.1 | HK97 gp10 family phage protein | - |
| LL229_RS12050 (LL229_03475) | - | 2313459..2313809 (-) | 351 | WP_002819792.1 | phage head closure protein | - |
| LL229_RS12055 (LL229_03480) | - | 2313784..2314107 (-) | 324 | WP_010905932.1 | head-tail connector protein | - |
Sequence
Protein
Download Length: 94 a.a. Molecular weight: 10783.02 Da Isoelectric Point: 5.0604
>NTDB_id=644976 LL229_RS11955 WP_010906314.1 2291865..2292149(-) (comGG) [Lactococcus lactis subsp. lactis strain 229]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDEKTYQF
SIHLKDGANFQIKN
Nucleotide
Download Length: 285 bp
>NTDB_id=644976 LL229_RS11955 WP_010906314.1 2291865..2292149(-) (comGG) [Lactococcus lactis subsp. lactis strain 229]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAAAACTTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGG | Lactococcus lactis subsp. cremoris KW2 |
59.14 |
98.936 |
0.585 |