Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   U722_RS14570 Genome accession   NC_023073
Coordinates   3052741..3052881 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens LFB112     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3047741..3057881
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U722_RS14545 (U722_15495) - 3048078..3048461 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  U722_RS14550 (U722_15500) comA 3048483..3049127 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  U722_RS14555 (U722_15505) comP 3049211..3051502 (-) 2292 WP_014305719.1 histidine kinase Regulator
  U722_RS14560 (U722_15510) comX 3051514..3051678 (-) 165 WP_007613432.1 competence pheromone ComX -
  U722_RS14565 (U722_15515) - 3051678..3052589 (-) 912 WP_014305720.1 polyprenyl synthetase family protein -
  U722_RS14570 (U722_15520) degQ 3052741..3052881 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  U722_RS14575 (U722_15530) - 3053347..3053688 (+) 342 WP_014305721.1 hypothetical protein -
  U722_RS14580 (U722_15535) - 3053695..3054915 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  U722_RS14585 (U722_15540) - 3055045..3056511 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  U722_RS14590 (U722_15545) - 3056529..3057080 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  U722_RS14595 (U722_15550) - 3057177..3057575 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=64220 U722_RS14570 WP_003152043.1 3052741..3052881(-) (degQ) [Bacillus amyloliquefaciens LFB112]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=64220 U722_RS14570 WP_003152043.1 3052741..3052881(-) (degQ) [Bacillus amyloliquefaciens LFB112]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment