Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   ODS73_RS02995 Genome accession   NZ_CP107038
Coordinates   560969..561118 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   Q9FBH1
Organism   Streptococcus pneumoniae strain BM6001     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Genomic Context

Location: 555969..566118
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ODS73_RS02960 (ODS73_02960) - 556949..557053 (+) 105 Protein_584 IS30 family transposase -
  ODS73_RS02965 (ODS73_02965) - 557073..557648 (+) 576 WP_000497530.1 CPBP family intramembrane glutamic endopeptidase -
  ODS73_RS02970 (ODS73_02970) - 557842..558063 (+) 222 WP_001821291.1 hypothetical protein -
  ODS73_RS02975 (ODS73_02975) - 558093..558497 (+) 405 WP_000717930.1 hypothetical protein -
  ODS73_RS02980 (ODS73_02980) - 559299..560102 (+) 804 Protein_588 IS5 family transposase -
  ODS73_RS02985 (ODS73_02985) blpM 560252..560506 (+) 255 WP_284060618.1 two-peptide bacteriocin subunit BlpM -
  ODS73_RS02990 (ODS73_02990) blpN 560522..560725 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  ODS73_RS02995 (ODS73_02995) cipB 560969..561118 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator
  ODS73_RS12185 - 561154..561219 (+) 66 Protein_592 ComC/BlpC family peptide pheromone/bacteriocin -
  ODS73_RS03000 (ODS73_03000) - 561222..561341 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  ODS73_RS03005 (ODS73_03005) - 561822..562180 (+) 359 Protein_594 immunity protein -
  ODS73_RS03010 (ODS73_03010) - 562341..563310 (+) 970 Protein_595 thioredoxin domain-containing protein -
  ODS73_RS03020 (ODS73_03020) - 563617..563850 (+) 234 WP_000379956.1 ComC/BlpC family leader-containing pheromone/bacteriocin -
  ODS73_RS03025 (ODS73_03025) - 563882..564571 (+) 690 WP_000760533.1 CPBP family intramembrane glutamic endopeptidase -
  ODS73_RS03030 (ODS73_03030) blpZ 564613..564846 (+) 234 WP_000276498.1 immunity protein BlpZ -
  ODS73_RS03035 (ODS73_03035) - 564997..565608 (+) 612 WP_000394036.1 CPBP family intramembrane glutamic endopeptidase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=640095 ODS73_RS02995 WP_001818346.1 560969..561118(+) (cipB) [Streptococcus pneumoniae strain BM6001]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=640095 ODS73_RS02995 WP_001818346.1 560969..561118(+) (cipB) [Streptococcus pneumoniae strain BM6001]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterProScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9FBH1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51