Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   LXA49_RS02860 Genome accession   NZ_CP089949
Coordinates   546527..546676 (+) Length   49 a.a.
NCBI ID   WP_001809846.1    Uniprot ID   Q00MV6
Organism   Streptococcus pneumoniae strain SN75752     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 544856..550760 546527..546676 within 0


Gene organization within MGE regions


Location: 544856..550760
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LXA49_RS02845 (LXA49_02840) - 544856..545660 (+) 805 Protein_568 IS5 family transposase -
  LXA49_RS02850 (LXA49_02845) blpM 545810..546064 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  LXA49_RS02855 (LXA49_02850) blpN 546080..546283 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  LXA49_RS02860 (LXA49_02855) cipB 546527..546676 (+) 150 WP_001809846.1 bacteriocin-like peptide BlpO Regulator
  LXA49_RS02865 (LXA49_02860) - 546780..546899 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  LXA49_RS02870 (LXA49_02865) - 547685..548104 (+) 420 WP_000877385.1 hypothetical protein -
  LXA49_RS02875 (LXA49_02870) - 548119..548808 (+) 690 WP_000760521.1 CPBP family intramembrane glutamic endopeptidase -
  LXA49_RS02880 (LXA49_02875) blpZ 548850..549083 (+) 234 WP_000276498.1 immunity protein BlpZ -
  LXA49_RS02885 (LXA49_02880) - 549414..550760 (+) 1347 WP_001808790.1 IS1380-like element ISSpn5 family transposase -

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5149.92 Da        Isoelectric Point: 4.0439

>NTDB_id=639399 LXA49_RS02860 WP_001809846.1 546527..546676(+) (cipB) [Streptococcus pneumoniae strain SN75752]
MNTKMMSQFSVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=639399 LXA49_RS02860 WP_001809846.1 546527..546676(+) (cipB) [Streptococcus pneumoniae strain SN75752]
ATGAATACAAAAATGATGTCACAATTTTCTGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q00MV6

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

53.061

100

0.531