Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LUV29_RS13350 Genome accession   NZ_CP089592
Coordinates   2557041..2557214 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain Bsi     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2552041..2562214
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUV29_RS13335 (LUV29_13335) gcvT 2552840..2553928 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  LUV29_RS13340 (LUV29_13340) hepAA 2554370..2556043 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  LUV29_RS13345 (LUV29_13345) yqhG 2556064..2556858 (+) 795 WP_003230200.1 YqhG family protein -
  LUV29_RS13350 (LUV29_13350) sinI 2557041..2557214 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  LUV29_RS13355 (LUV29_13355) sinR 2557248..2557583 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LUV29_RS13360 (LUV29_13360) tasA 2557676..2558461 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  LUV29_RS13365 (LUV29_13365) sipW 2558525..2559097 (-) 573 WP_003246088.1 signal peptidase I SipW -
  LUV29_RS13370 (LUV29_13370) tapA 2559081..2559842 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  LUV29_RS13375 (LUV29_13375) yqzG 2560114..2560440 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  LUV29_RS13380 (LUV29_13380) spoIITA 2560482..2560661 (-) 180 WP_003230176.1 YqzE family protein -
  LUV29_RS13385 (LUV29_13385) comGG 2560732..2561106 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  LUV29_RS13390 (LUV29_13390) comGF 2561107..2561490 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  LUV29_RS13395 (LUV29_13395) comGE 2561516..2561863 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=638222 LUV29_RS13350 WP_003230187.1 2557041..2557214(+) (sinI) [Bacillus subtilis strain Bsi]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=638222 LUV29_RS13350 WP_003230187.1 2557041..2557214(+) (sinI) [Bacillus subtilis strain Bsi]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1