Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LUA14_RS16490 Genome accession   NZ_CP089530
Coordinates   3261935..3262075 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain LS1-002-014s     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3256935..3267075
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUA14_RS16465 (LUA14_16465) - 3257262..3257645 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  LUA14_RS16470 (LUA14_16470) comA 3257667..3258311 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  LUA14_RS16475 (LUA14_16475) comP 3258392..3260698 (-) 2307 WP_232603436.1 sensor histidine kinase Regulator
  LUA14_RS16480 (LUA14_16480) comX 3260717..3260893 (-) 177 WP_015240484.1 competence pheromone ComX -
  LUA14_RS16485 (LUA14_16485) - 3260908..3261783 (-) 876 WP_025285191.1 polyprenyl synthetase family protein -
  LUA14_RS16490 (LUA14_16490) degQ 3261935..3262075 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LUA14_RS16495 (LUA14_16495) - 3262540..3262881 (+) 342 WP_124692757.1 hypothetical protein -
  LUA14_RS16500 (LUA14_16500) - 3262888..3264111 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  LUA14_RS16505 (LUA14_16505) - 3264241..3265707 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  LUA14_RS16510 (LUA14_16510) - 3265725..3266276 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  LUA14_RS16515 (LUA14_16515) - 3266373..3266771 (-) 399 WP_003152031.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=637999 LUA14_RS16490 WP_003152043.1 3261935..3262075(-) (degQ) [Bacillus amyloliquefaciens strain LS1-002-014s]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=637999 LUA14_RS16490 WP_003152043.1 3261935..3262075(-) (degQ) [Bacillus amyloliquefaciens strain LS1-002-014s]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891