Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LUA14_RS13545 Genome accession   NZ_CP089530
Coordinates   2708927..2709100 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain LS1-002-014s     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2703927..2714100
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUA14_RS13530 (LUA14_13530) gcvT 2704740..2705840 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  LUA14_RS13535 (LUA14_13535) - 2706264..2707934 (+) 1671 WP_132105375.1 DEAD/DEAH box helicase -
  LUA14_RS13540 (LUA14_13540) - 2707956..2708750 (+) 795 WP_208480294.1 YqhG family protein -
  LUA14_RS13545 (LUA14_13545) sinI 2708927..2709100 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LUA14_RS13550 (LUA14_13550) sinR 2709134..2709469 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LUA14_RS13555 (LUA14_13555) tasA 2709517..2710302 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LUA14_RS13560 (LUA14_13560) sipW 2710367..2710951 (-) 585 WP_015240205.1 signal peptidase I SipW -
  LUA14_RS13565 (LUA14_13565) tapA 2710923..2711594 (-) 672 WP_124692843.1 amyloid fiber anchoring/assembly protein TapA -
  LUA14_RS13570 (LUA14_13570) - 2711853..2712182 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LUA14_RS13575 (LUA14_13575) - 2712222..2712401 (-) 180 WP_003153093.1 YqzE family protein -
  LUA14_RS13580 (LUA14_13580) comGG 2712458..2712835 (-) 378 WP_015240208.1 competence type IV pilus minor pilin ComGG Machinery gene
  LUA14_RS13585 (LUA14_13585) comGF 2712836..2713336 (-) 501 WP_256994853.1 competence type IV pilus minor pilin ComGF -
  LUA14_RS13590 (LUA14_13590) comGE 2713245..2713559 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LUA14_RS13595 (LUA14_13595) comGD 2713543..2713980 (-) 438 WP_015240210.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=637978 LUA14_RS13545 WP_003153105.1 2708927..2709100(+) (sinI) [Bacillus amyloliquefaciens strain LS1-002-014s]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=637978 LUA14_RS13545 WP_003153105.1 2708927..2709100(+) (sinI) [Bacillus amyloliquefaciens strain LS1-002-014s]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702