Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LUA14_RS13545 | Genome accession | NZ_CP089530 |
| Coordinates | 2708927..2709100 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain LS1-002-014s | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2703927..2714100
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUA14_RS13530 (LUA14_13530) | gcvT | 2704740..2705840 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LUA14_RS13535 (LUA14_13535) | - | 2706264..2707934 (+) | 1671 | WP_132105375.1 | DEAD/DEAH box helicase | - |
| LUA14_RS13540 (LUA14_13540) | - | 2707956..2708750 (+) | 795 | WP_208480294.1 | YqhG family protein | - |
| LUA14_RS13545 (LUA14_13545) | sinI | 2708927..2709100 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| LUA14_RS13550 (LUA14_13550) | sinR | 2709134..2709469 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LUA14_RS13555 (LUA14_13555) | tasA | 2709517..2710302 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| LUA14_RS13560 (LUA14_13560) | sipW | 2710367..2710951 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| LUA14_RS13565 (LUA14_13565) | tapA | 2710923..2711594 (-) | 672 | WP_124692843.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LUA14_RS13570 (LUA14_13570) | - | 2711853..2712182 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| LUA14_RS13575 (LUA14_13575) | - | 2712222..2712401 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| LUA14_RS13580 (LUA14_13580) | comGG | 2712458..2712835 (-) | 378 | WP_015240208.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LUA14_RS13585 (LUA14_13585) | comGF | 2712836..2713336 (-) | 501 | WP_256994853.1 | competence type IV pilus minor pilin ComGF | - |
| LUA14_RS13590 (LUA14_13590) | comGE | 2713245..2713559 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| LUA14_RS13595 (LUA14_13595) | comGD | 2713543..2713980 (-) | 438 | WP_015240210.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=637978 LUA14_RS13545 WP_003153105.1 2708927..2709100(+) (sinI) [Bacillus amyloliquefaciens strain LS1-002-014s]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=637978 LUA14_RS13545 WP_003153105.1 2708927..2709100(+) (sinI) [Bacillus amyloliquefaciens strain LS1-002-014s]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |