Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   LUZ01_RS02390 Genome accession   NZ_CP089504
Coordinates   447768..448214 (+) Length   148 a.a.
NCBI ID   WP_001790850.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 3581_IA_ST247     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 434887..492289 447768..448214 within 0


Gene organization within MGE regions


Location: 434887..492289
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUZ01_RS02315 - 435638..436423 (+) 786 WP_001213908.1 metal ABC transporter ATP-binding protein -
  LUZ01_RS02320 - 436465..437328 (+) 864 WP_000564316.1 metal ABC transporter permease -
  LUZ01_RS02325 - 437315..437725 (+) 411 WP_001095260.1 Fur family transcriptional regulator -
  LUZ01_RS02330 - 438001..438600 (+) 600 WP_000863556.1 superoxide dismutase -
  LUZ01_RS02335 - 438721..440796 (+) 2076 WP_000919772.1 penicillin-binding protein 2 -
  LUZ01_RS02340 rpmG 440909..441058 (+) 150 WP_001265709.1 50S ribosomal protein L33 -
  LUZ01_RS02345 - 441267..441806 (+) 540 WP_000164545.1 5-formyltetrahydrofolate cyclo-ligase -
  LUZ01_RS02350 - 441818..443281 (+) 1464 WP_001017867.1 rhomboid family intramembrane serine protease -
  LUZ01_RS02355 - 443262..443465 (+) 204 WP_000087561.1 YqgQ family protein -
  LUZ01_RS02360 - 443462..444448 (+) 987 WP_000161314.1 ROK family glucokinase -
  LUZ01_RS02365 - 444448..444777 (+) 330 WP_001018871.1 MTH1187 family thiamine-binding protein -
  LUZ01_RS02370 - 444774..445397 (+) 624 WP_001223008.1 MBL fold metallo-hydrolase -
  LUZ01_RS02375 comGA 445449..446423 (+) 975 WP_000697228.1 competence type IV pilus ATPase ComGA Machinery gene
  LUZ01_RS02380 comGB 446395..447465 (+) 1071 WP_000775708.1 competence type IV pilus assembly protein ComGB Machinery gene
  LUZ01_RS02385 comGC 447479..447790 (+) 312 WP_000472256.1 competence type IV pilus major pilin ComGC Machinery gene
  LUZ01_RS02390 comGD 447768..448214 (+) 447 WP_001790850.1 competence type IV pilus minor pilin ComGD Machinery gene
  LUZ01_RS02395 comGE 448201..448500 (+) 300 WP_000844413.1 hypothetical protein Machinery gene
  LUZ01_RS02400 comGF 448418..448915 (+) 498 WP_001789864.1 competence type IV pilus minor pilin ComGF Machinery gene
  LUZ01_RS02405 - 449012..449158 (+) 147 WP_001789879.1 hypothetical protein -
  LUZ01_RS02410 - 449148..449672 (+) 525 WP_001015117.1 shikimate kinase -
  LUZ01_RS02415 gcvT 449831..450922 (+) 1092 WP_000093349.1 glycine cleavage system aminomethyltransferase GcvT -
  LUZ01_RS02420 gcvPA 450942..452288 (+) 1347 WP_000019693.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPA -
  LUZ01_RS02425 gcvPB 452281..453753 (+) 1473 WP_000202192.1 aminomethyl-transferring glycine dehydrogenase subunit GcvPB -
  LUZ01_RS02430 - 454118..454504 (-) 387 WP_001276571.1 rhodanese-like domain-containing protein -
  LUZ01_RS02435 - 454662..455492 (+) 831 WP_000141109.1 biotin/lipoate A/B protein ligase family protein -
  LUZ01_RS02440 - 455556..455774 (-) 219 WP_001244298.1 SA1362 family protein -
  LUZ01_RS02445 - 455788..456369 (-) 582 WP_000737686.1 hypothetical protein -
  LUZ01_RS02450 - 456474..457535 (+) 1062 WP_000087107.1 Xaa-Pro peptidase family protein -
  LUZ01_RS02455 efp 457561..458118 (+) 558 WP_000626504.1 elongation factor P -
  LUZ01_RS02460 - 458513..458797 (+) 285 WP_000134545.1 hypothetical protein -
  LUZ01_RS02465 - 458948..459268 (+) 321 WP_000805733.1 DUF961 family protein -
  LUZ01_RS02470 - 459282..459584 (+) 303 WP_000386891.1 hypothetical protein -
  LUZ01_RS02475 - 459759..460850 (+) 1092 WP_000172943.1 replication initiation factor domain-containing protein -
  LUZ01_RS02480 - 460911..461966 (+) 1056 WP_000692002.1 conjugal transfer protein -
  LUZ01_RS02485 - 461971..462231 (+) 261 WP_000015639.1 TcpD family membrane protein -
  LUZ01_RS02490 - 462243..462626 (+) 384 WP_000358144.1 TcpE family conjugal transfer membrane protein -
  LUZ01_RS02495 - 462661..465156 (+) 2496 WP_001049264.1 ATP-binding protein -
  LUZ01_RS02500 - 465210..466568 (+) 1359 WP_001251212.1 FtsK/SpoIIIE domain-containing protein -
  LUZ01_RS02505 - 466573..468420 (+) 1848 WP_000681143.1 CD3337/EF1877 family mobilome membrane protein -
  LUZ01_RS02510 - 468410..469456 (+) 1047 WP_000247469.1 CHAP domain-containing protein -
  LUZ01_RS02515 - 469463..470053 (+) 591 WP_000810443.1 hypothetical protein -
  LUZ01_RS02520 - 470109..470450 (+) 342 WP_001255377.1 cystatin-like fold lipoprotein -
  LUZ01_RS02525 - 470559..471062 (+) 504 WP_000746371.1 transposase -
  LUZ01_RS02530 - 471091..471579 (+) 489 WP_176318786.1 IS30 family transposase -
  LUZ01_RS02535 accB 471934..472398 (+) 465 WP_001009516.1 acetyl-CoA carboxylase biotin carboxyl carrier protein -
  LUZ01_RS02540 accC 472398..473753 (+) 1356 WP_000756612.1 acetyl-CoA carboxylase biotin carboxylase subunit -
  LUZ01_RS02545 - 473768..474130 (+) 363 WP_000241588.1 Asp23/Gls24 family envelope stress response protein -
  LUZ01_RS02550 nusB 474190..474579 (+) 390 WP_000087385.1 transcription antitermination factor NusB -
  LUZ01_RS02555 xseA 474596..475933 (+) 1338 WP_001286928.1 exodeoxyribonuclease VII large subunit -
  LUZ01_RS02560 - 475926..476156 (+) 231 WP_000159865.1 exodeoxyribonuclease VII small subunit -
  LUZ01_RS02565 - 476134..477015 (+) 882 WP_000183378.1 polyprenyl synthetase family protein -
  LUZ01_RS02570 ahrC 477447..477899 (+) 453 WP_001124985.1 transcriptional regulator AhrC/ArgR -
  LUZ01_RS02575 recN 477915..479594 (+) 1680 WP_000942211.1 DNA repair protein RecN -
  LUZ01_RS02580 lpdA 479745..481166 (+) 1422 WP_001291535.1 dihydrolipoyl dehydrogenase -
  LUZ01_RS02585 - 481182..482174 (+) 993 WP_000568353.1 thiamine pyrophosphate-dependent dehydrogenase E1 component subunit alpha -
  LUZ01_RS02590 - 482174..483157 (+) 984 WP_001096642.1 alpha-ketoacid dehydrogenase subunit beta -
  LUZ01_RS02595 - 483170..484444 (+) 1275 WP_000406839.1 dihydrolipoamide acetyltransferase family protein -
  LUZ01_RS02600 brxB 484795..485232 (+) 438 WP_000367419.1 bacilliredoxin BrxB -
  LUZ01_RS02605 - 485246..486226 (+) 981 WP_000916195.1 aromatic acid exporter family protein -
  LUZ01_RS02610 prli42 486353..486532 (-) 180 WP_001789875.1 stressosome-associated protein Prli42 -
  LUZ01_RS02615 - 486795..487928 (+) 1134 WP_000606676.1 tripeptidase T -
  LUZ01_RS02620 gndA 487996..489402 (+) 1407 WP_000193707.1 NADP-dependent phosphogluconate dehydrogenase -
  LUZ01_RS02625 - 489621..489992 (+) 372 WP_000413437.1 VOC family protein -
  LUZ01_RS02630 - 489931..490185 (+) 255 WP_001791638.1 hypothetical protein -
  LUZ01_RS02635 - 490186..491205 (+) 1020 WP_000256338.1 LacI family DNA-binding transcriptional regulator -

Sequence

Protein


Download         Length: 148 a.a.        Molecular weight: 17213.42 Da        Isoelectric Point: 10.3682

>NTDB_id=637730 LUZ01_RS02390 WP_001790850.1 447768..448214(+) (comGD) [Staphylococcus aureus strain 3581_IA_ST247]
MEKQLQIRKQSAFTMIEMLVVMMLISIFLLLTMTSKGLSNLRVIDDEANIISFITELNYIKSQAIANQGYINVRFYENSD
TIKVIENNKIRFLKLKVGKIINVAKVDIIAFDKKGNINKFGSITIYNNNSIYRIIFHIEKGRIRYEKL

Nucleotide


Download         Length: 447 bp        

>NTDB_id=637730 LUZ01_RS02390 WP_001790850.1 447768..448214(+) (comGD) [Staphylococcus aureus strain 3581_IA_ST247]
ATGGAGAAGCAGTTGCAAATTAGAAAGCAGTCAGCATTTACTATGATTGAGATGCTTGTGGTAATGATGTTAATCAGTAT
ATTTCTACTTTTGACAATGACATCTAAAGGATTAAGCAATCTTAGAGTAATAGATGATGAGGCAAATATCATTTCTTTTA
TTACTGAATTGAATTATATTAAGTCGCAAGCTATAGCAAATCAAGGATATATCAATGTTAGATTTTATGAAAACAGTGAC
ACTATTAAAGTAATAGAGAATAATAAAATACGATTTCTAAAATTAAAAGTAGGCAAAATAATTAATGTTGCAAAAGTTGA
TATTATTGCCTTTGATAAAAAAGGGAATATCAATAAATTTGGTAGCATAACAATTTACAATAACAATTCAATTTATAGAA
TAATATTCCATATTGAAAAAGGAAGAATTCGTTATGAAAAGCTATAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-31)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Staphylococcus aureus MW2

99.324

100

0.993
  comGD Staphylococcus aureus N315

99.324

100

0.993