Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | YBT1518_RS21340 | Genome accession | NC_022873 |
| Coordinates | 4296810..4297088 (-) | Length | 92 a.a. |
| NCBI ID | WP_023522898.1 | Uniprot ID | - |
| Organism | Bacillus thuringiensis YBT-1518 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4263289..4309946 | 4296810..4297088 | within | 0 |
Gene organization within MGE regions
Location: 4263289..4309946
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| YBT1518_RS21165 (YBT1518_21510) | - | 4263289..4264062 (-) | 774 | WP_023522869.1 | N-acetylmuramoyl-L-alanine amidase | - |
| YBT1518_RS21170 (YBT1518_21515) | - | 4264062..4264502 (-) | 441 | WP_023522870.1 | holin family protein | - |
| YBT1518_RS21180 (YBT1518_21525) | - | 4264518..4265477 (-) | 960 | Protein_4231 | tyrosine-type recombinase/integrase | - |
| YBT1518_RS21185 (YBT1518_21530) | ltrA | 4265577..4266851 (-) | 1275 | WP_023520826.1 | group II intron reverse transcriptase/maturase | - |
| YBT1518_RS21190 (YBT1518_21535) | - | 4267368..4273172 (-) | 5805 | WP_023522873.1 | phage tail spike protein | - |
| YBT1518_RS21195 (YBT1518_21540) | - | 4273169..4274644 (-) | 1476 | WP_023522874.1 | distal tail protein Dit | - |
| YBT1518_RS21200 (YBT1518_21545) | - | 4274686..4278309 (-) | 3624 | WP_023522875.1 | Prophage LambdaBa01, membrane protein | - |
| YBT1518_RS38325 | - | 4278544..4278900 (-) | 357 | Protein_4236 | hypothetical protein | - |
| YBT1518_RS21210 (YBT1518_21555) | - | 4278907..4279500 (-) | 594 | WP_023522877.1 | major tail protein | - |
| YBT1518_RS21215 (YBT1518_21560) | - | 4279501..4279830 (-) | 330 | WP_023522878.1 | hypothetical protein | - |
| YBT1518_RS21220 (YBT1518_21565) | - | 4279830..4280171 (-) | 342 | WP_023522879.1 | HK97 gp10 family phage protein | - |
| YBT1518_RS21225 (YBT1518_21570) | - | 4280173..4280523 (-) | 351 | WP_023522880.1 | phage head closure protein | - |
| YBT1518_RS21230 (YBT1518_21575) | - | 4280525..4280818 (-) | 294 | WP_023522881.1 | hypothetical protein | - |
| YBT1518_RS21235 (YBT1518_21580) | - | 4280831..4281994 (-) | 1164 | WP_023522882.1 | phage major capsid protein | - |
| YBT1518_RS21240 (YBT1518_21585) | - | 4282014..4282790 (-) | 777 | WP_023522883.1 | head maturation protease, ClpP-related | - |
| YBT1518_RS21245 (YBT1518_21590) | - | 4283091..4284284 (+) | 1194 | WP_023521170.1 | IS110 family transposase | - |
| YBT1518_RS21250 (YBT1518_21595) | - | 4284378..4285463 (-) | 1086 | WP_043924828.1 | phage portal protein | - |
| YBT1518_RS21255 (YBT1518_21600) | - | 4285529..4287187 (-) | 1659 | WP_023522885.1 | terminase TerL endonuclease subunit | - |
| YBT1518_RS21260 (YBT1518_21605) | - | 4287184..4287519 (-) | 336 | WP_043924700.1 | P27 family phage terminase small subunit | - |
| YBT1518_RS21270 (YBT1518_21610) | - | 4287673..4288008 (-) | 336 | WP_023522887.1 | HNH endonuclease | - |
| YBT1518_RS21275 (YBT1518_21615) | - | 4288024..4288332 (-) | 309 | WP_023522888.1 | hypothetical protein | - |
| YBT1518_RS21280 (YBT1518_21620) | - | 4288815..4289027 (-) | 213 | WP_023522889.1 | hypothetical protein | - |
| YBT1518_RS21285 (YBT1518_21625) | - | 4290134..4290325 (-) | 192 | WP_023522890.1 | hypothetical protein | - |
| YBT1518_RS21290 (YBT1518_21630) | - | 4290801..4291022 (-) | 222 | WP_023522891.1 | hypothetical protein | - |
| YBT1518_RS21295 (YBT1518_21635) | - | 4291239..4291781 (-) | 543 | WP_006929356.1 | site-specific integrase | - |
| YBT1518_RS21300 (YBT1518_21640) | - | 4291781..4292263 (-) | 483 | WP_023522892.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| YBT1518_RS35460 (YBT1518_21645) | - | 4292543..4292665 (-) | 123 | WP_000645584.1 | DUF3983 domain-containing protein | - |
| YBT1518_RS21305 (YBT1518_21650) | - | 4292918..4293163 (+) | 246 | WP_001013298.1 | hypothetical protein | - |
| YBT1518_RS35465 (YBT1518_21655) | - | 4294034..4294438 (+) | 405 | WP_023522893.1 | helix-turn-helix domain-containing protein | - |
| YBT1518_RS21315 (YBT1518_21660) | - | 4295034..4295309 (-) | 276 | WP_023522894.1 | hypothetical protein | - |
| YBT1518_RS21320 (YBT1518_21665) | - | 4295493..4295975 (-) | 483 | WP_023522895.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| YBT1518_RS21325 (YBT1518_21670) | - | 4295995..4296246 (-) | 252 | WP_023522896.1 | hypothetical protein | - |
| YBT1518_RS35470 (YBT1518_21675) | - | 4296272..4296439 (-) | 168 | WP_000717826.1 | DUF3954 domain-containing protein | - |
| YBT1518_RS21335 (YBT1518_21680) | - | 4296458..4296817 (-) | 360 | WP_023522897.1 | hypothetical protein | - |
| YBT1518_RS21340 (YBT1518_21685) | abrB | 4296810..4297088 (-) | 279 | WP_023522898.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| YBT1518_RS21345 (YBT1518_21690) | - | 4297105..4297299 (-) | 195 | WP_023522899.1 | hypothetical protein | - |
| YBT1518_RS21350 (YBT1518_21695) | - | 4297380..4297604 (+) | 225 | WP_023522900.1 | hypothetical protein | - |
| YBT1518_RS21355 (YBT1518_21700) | - | 4297601..4297804 (-) | 204 | WP_023522901.1 | hypothetical protein | - |
| YBT1518_RS21360 (YBT1518_21705) | - | 4297821..4298696 (-) | 876 | WP_052364204.1 | ATP-binding protein | - |
| YBT1518_RS21365 (YBT1518_21710) | - | 4298635..4299522 (-) | 888 | WP_023522903.1 | DnaD domain-containing protein | - |
| YBT1518_RS37640 (YBT1518_21715) | - | 4299529..4299705 (-) | 177 | WP_023522904.1 | hypothetical protein | - |
| YBT1518_RS37645 (YBT1518_21720) | - | 4299735..4299899 (-) | 165 | WP_023522905.1 | hypothetical protein | - |
| YBT1518_RS21380 (YBT1518_21725) | - | 4299956..4300156 (-) | 201 | WP_023522906.1 | helix-turn-helix domain-containing protein | - |
| YBT1518_RS21385 (YBT1518_21730) | - | 4300215..4300436 (-) | 222 | WP_023522907.1 | helix-turn-helix transcriptional regulator | - |
| YBT1518_RS21390 (YBT1518_21735) | - | 4300657..4301025 (+) | 369 | WP_023522908.1 | helix-turn-helix domain-containing protein | - |
| YBT1518_RS38330 (YBT1518_21740) | - | 4301041..4301172 (-) | 132 | WP_255300911.1 | hypothetical protein | - |
| YBT1518_RS37650 (YBT1518_21745) | - | 4301293..4301442 (-) | 150 | WP_023522910.1 | hypothetical protein | - |
| YBT1518_RS21395 (YBT1518_21750) | - | 4301455..4302552 (-) | 1098 | WP_023522911.1 | AimR family lysis-lysogeny pheromone receptor | - |
| YBT1518_RS21400 (YBT1518_21755) | - | 4302990..4303334 (+) | 345 | WP_023522912.1 | helix-turn-helix domain-containing protein | - |
| YBT1518_RS37655 (YBT1518_21760) | - | 4303424..4303585 (-) | 162 | WP_023522913.1 | hypothetical protein | - |
| YBT1518_RS37660 (YBT1518_21765) | - | 4303582..4303740 (-) | 159 | WP_000924328.1 | hypothetical protein | - |
| YBT1518_RS37665 (YBT1518_21770) | - | 4303742..4303900 (-) | 159 | WP_023522914.1 | hypothetical protein | - |
| YBT1518_RS37670 (YBT1518_21775) | - | 4303923..4304072 (-) | 150 | WP_023522915.1 | hypothetical protein | - |
| YBT1518_RS21405 (YBT1518_21780) | - | 4304182..4304487 (-) | 306 | WP_000511407.1 | STAS-like domain-containing protein | - |
| YBT1518_RS21410 (YBT1518_21785) | - | 4304478..4305380 (-) | 903 | WP_023522916.1 | ATP-binding protein | - |
| YBT1518_RS21415 (YBT1518_21790) | - | 4305609..4306739 (+) | 1131 | WP_023522917.1 | site-specific integrase | - |
| YBT1518_RS21420 (YBT1518_21795) | - | 4306934..4308115 (+) | 1182 | WP_003271282.1 | nucleotidyltransferase | - |
| YBT1518_RS21425 (YBT1518_21800) | - | 4308125..4309162 (-) | 1038 | WP_023522918.1 | SepM family pheromone-processing serine protease | - |
| YBT1518_RS21430 (YBT1518_21805) | - | 4309155..4309946 (-) | 792 | WP_000662590.1 | patatin-like phospholipase family protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10049.60 Da Isoelectric Point: 6.4649
>NTDB_id=63628 YBT1518_RS21340 WP_023522898.1 4296810..4297088(-) (abrB) [Bacillus thuringiensis YBT-1518]
MKNTGVTRKVDELGRVVIPVELRRTLGIAEGTALDFHVDVENVVLRKQDKSCFVTGEVSESNIELLGGRMFLSKAGANEL
LDALEKSVKVHA
MKNTGVTRKVDELGRVVIPVELRRTLGIAEGTALDFHVDVENVVLRKQDKSCFVTGEVSESNIELLGGRMFLSKAGANEL
LDALEKSVKVHA
Nucleotide
Download Length: 279 bp
>NTDB_id=63628 YBT1518_RS21340 WP_023522898.1 4296810..4297088(-) (abrB) [Bacillus thuringiensis YBT-1518]
ATGAAAAATACAGGCGTTACAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTTGAGTTACGCAGGACTTTAGG
GATTGCTGAAGGGACAGCACTAGATTTTCATGTTGATGTGGAAAACGTCGTTTTGAGAAAACAAGATAAGTCATGCTTTG
TGACGGGGGAAGTTTCTGAATCAAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGCGGGAGCAAATGAATTA
CTTGATGCTCTTGAAAAGAGTGTGAAGGTACATGCCTAA
ATGAAAAATACAGGCGTTACAAGAAAAGTGGACGAGCTAGGGCGTGTAGTAATTCCGGTTGAGTTACGCAGGACTTTAGG
GATTGCTGAAGGGACAGCACTAGATTTTCATGTTGATGTGGAAAACGTCGTTTTGAGAAAACAAGATAAGTCATGCTTTG
TGACGGGGGAAGTTTCTGAATCAAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGCGGGAGCAAATGAATTA
CTTGATGCTCTTGAAAAGAGTGTGAAGGTACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
53.846 |
98.913 |
0.533 |