Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   YBT1518_RS09270 Genome accession   NC_022873
Coordinates   1812970..1813248 (+) Length   92 a.a.
NCBI ID   WP_023521541.1    Uniprot ID   A0A9W3PF44
Organism   Bacillus thuringiensis YBT-1518     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Genomic Context

Location: 1807970..1818248
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  YBT1518_RS09245 (YBT1518_09005) - 1808718..1809977 (+) 1260 WP_241752530.1 AimR family lysis-lysogeny pheromone receptor -
  YBT1518_RS38115 - 1810159..1810290 (+) 132 WP_256680778.1 hypothetical protein -
  YBT1518_RS09250 (YBT1518_09010) - 1810301..1810648 (-) 348 WP_023521535.1 helix-turn-helix domain-containing protein -
  YBT1518_RS09255 (YBT1518_09015) - 1810818..1811045 (+) 228 WP_023521536.1 helix-turn-helix transcriptional regulator -
  YBT1518_RS37485 (YBT1518_09020) - 1811084..1811242 (+) 159 WP_023521537.1 hypothetical protein -
  YBT1518_RS37490 (YBT1518_09025) - 1811315..1811470 (+) 156 WP_023521538.1 hypothetical protein -
  YBT1518_RS09260 (YBT1518_09030) - 1811526..1811846 (+) 321 WP_023521539.1 germination protein PF -
  YBT1518_RS09265 (YBT1518_09035) - 1811974..1812966 (+) 993 WP_023521540.1 DnaD domain-containing protein -
  YBT1518_RS09270 (YBT1518_09040) abrB 1812970..1813248 (+) 279 WP_023521541.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  YBT1518_RS09275 (YBT1518_09045) - 1813241..1813600 (+) 360 WP_023521542.1 hypothetical protein -
  YBT1518_RS34585 (YBT1518_09050) - 1813619..1813783 (+) 165 WP_023521543.1 DUF3954 domain-containing protein -
  YBT1518_RS09285 (YBT1518_09055) - 1813809..1814282 (+) 474 WP_023521544.1 hypothetical protein -
  YBT1518_RS09290 (YBT1518_09060) - 1814308..1814817 (+) 510 WP_023521545.1 dUTP diphosphatase -
  YBT1518_RS09295 (YBT1518_09065) - 1814821..1815294 (+) 474 WP_023521546.1 hypothetical protein -
  YBT1518_RS09300 (YBT1518_09070) - 1815374..1815559 (+) 186 WP_023521547.1 hypothetical protein -
  YBT1518_RS09305 (YBT1518_09075) - 1815596..1815994 (+) 399 WP_043924639.1 hypothetical protein -
  YBT1518_RS09310 (YBT1518_09080) - 1816078..1816368 (+) 291 WP_023521549.1 hypothetical protein -
  YBT1518_RS09315 (YBT1518_09085) - 1816413..1816787 (+) 375 WP_023521550.1 hypothetical protein -
  YBT1518_RS37495 (YBT1518_09090) - 1816869..1817372 (+) 504 WP_241752531.1 DNA cytosine methyltransferase -
  YBT1518_RS37500 - 1817326..1817754 (+) 429 WP_043924771.1 DNA cytosine methyltransferase -
  YBT1518_RS34595 (YBT1518_09100) - 1817792..1817917 (+) 126 WP_023521553.1 DUF3983 domain-containing protein -
  YBT1518_RS37505 (YBT1518_09105) - 1818033..1818203 (+) 171 WP_023521554.1 hypothetical protein -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10013.58 Da        Isoelectric Point: 4.8140

>NTDB_id=63619 YBT1518_RS09270 WP_023521541.1 1812970..1813248(+) (abrB) [Bacillus thuringiensis YBT-1518]
MKNTGVVRKVDELGRVVIPVELRRTLGIAEGTALDFQVYGENIILKKQETSCFVTGEVSESNIELLGGRMFLSKEGASEL
LDILQKSGMANA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=63619 YBT1518_RS09270 WP_023521541.1 1812970..1813248(+) (abrB) [Bacillus thuringiensis YBT-1518]
ATGAAAAACACAGGTGTTGTAAGAAAAGTTGATGAGCTAGGACGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGCACAGCACTAGATTTTCAAGTTTATGGAGAAAACATTATTTTAAAGAAACAAGAAACGTCATGCTTTG
TAACGGGTGAAGTTTCTGAATCTAACATCGAATTACTGGGCGGTCGAATGTTTTTGAGTAAGGAAGGCGCAAGTGAATTG
CTGGACATTCTTCAAAAGAGTGGGATGGCAAATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-86)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

62.069

94.565

0.587

Multiple sequence alignment