Detailed information    

insolico Bioinformatically predicted

Overview

Name   nucA/comI   Type   Machinery gene
Locus tag   LT232_RS04220 Genome accession   NZ_CP089287
Coordinates   850240..850674 (-) Length   144 a.a.
NCBI ID   WP_015417516.1    Uniprot ID   -
Organism   Bacillus velezensis strain GSBZ09     
Function   cleavage of dsDNA into ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 825039..849369 850240..850674 flank 871
IScluster/Tn 848218..849369 850240..850674 flank 871


Gene organization within MGE regions


Location: 825039..850674
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT232_RS04060 (LT232_04060) - 825039..825641 (-) 603 WP_059366946.1 tetratricopeptide repeat protein -
  LT232_RS04065 (LT232_04065) - 825953..826144 (-) 192 WP_160223069.1 hypothetical protein -
  LT232_RS04070 (LT232_04070) - 826424..827633 (+) 1210 Protein_811 ribonuclease YeeF family protein -
  LT232_RS04075 (LT232_04075) - 827744..828097 (+) 354 WP_079978832.1 hypothetical protein -
  LT232_RS04080 (LT232_04080) - 828123..828404 (+) 282 WP_059366950.1 hypothetical protein -
  LT232_RS04085 (LT232_04085) - 828460..828876 (-) 417 WP_059366952.1 hypothetical protein -
  LT232_RS04090 (LT232_04090) - 828995..829258 (-) 264 Protein_815 peptidoglycan-binding domain-containing protein -
  LT232_RS04095 (LT232_04095) glnA 829656..830990 (-) 1335 WP_039063137.1 type I glutamate--ammonia ligase -
  LT232_RS04100 (LT232_04100) - 831048..831452 (-) 405 WP_007410366.1 MerR family transcriptional regulator -
  LT232_RS04105 (LT232_04105) - 831562..832827 (-) 1266 WP_012117612.1 aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme -
  LT232_RS04110 (LT232_04110) hflX 832844..834106 (-) 1263 WP_032866017.1 GTPase HflX -
  LT232_RS04115 (LT232_04115) spoVK 834236..835204 (-) 969 WP_015417523.1 stage V sporulation protein K -
  LT232_RS04120 (LT232_04120) - 835511..836269 (+) 759 WP_012117610.1 N-acetylmuramoyl-L-alanine amidase -
  LT232_RS04125 (LT232_04125) - 836319..836939 (-) 621 WP_012117609.1 hypothetical protein -
  LT232_RS04130 (LT232_04130) nrdF 836988..837977 (-) 990 WP_012117608.1 class 1b ribonucleoside-diphosphate reductase subunit beta -
  LT232_RS04135 (LT232_04135) nrdE 837995..840097 (-) 2103 WP_007611605.1 class 1b ribonucleoside-diphosphate reductase subunit alpha -
  LT232_RS04140 (LT232_04140) nrdI 840057..840449 (-) 393 WP_003154061.1 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI -
  LT232_RS04145 (LT232_04145) - 840709..840924 (-) 216 WP_003154062.1 hypothetical protein -
  LT232_RS04150 (LT232_04150) - 841007..841282 (-) 276 WP_007410374.1 YmzC family protein -
  LT232_RS04155 (LT232_04155) hfq 841379..841600 (-) 222 WP_003154064.1 RNA chaperone Hfq -
  LT232_RS04160 (LT232_04160) miaA 841640..842584 (-) 945 WP_007410375.1 tRNA (adenosine(37)-N6)-dimethylallyltransferase MiaA -
  LT232_RS04165 (LT232_04165) - 842683..843087 (-) 405 WP_032866019.1 YmaF family protein -
  LT232_RS04170 (LT232_04170) - 843189..843494 (+) 306 WP_015239898.1 hypothetical protein -
  LT232_RS04175 (LT232_04175) - 843633..843947 (+) 315 WP_007410378.1 DMT family transporter -
  LT232_RS04180 (LT232_04180) - 843965..844318 (+) 354 WP_007410379.1 DMT family transporter -
  LT232_RS04185 (LT232_04185) - 844332..844784 (-) 453 WP_007410380.1 OsmC family protein -
  LT232_RS04190 (LT232_04190) - 844844..845551 (-) 708 WP_007410381.1 poly-gamma-glutamate hydrolase family protein -
  LT232_RS04195 (LT232_04195) - 845807..846040 (-) 234 WP_015239897.1 hypothetical protein -
  LT232_RS04200 (LT232_04200) - 846219..847547 (+) 1329 WP_039063127.1 S8 family peptidase -
  LT232_RS04205 (LT232_04205) - 847740..848102 (+) 363 WP_007410383.1 hypothetical protein -
  LT232_RS04210 (LT232_04210) - 848218..849369 (+) 1152 Protein_839 IS3 family transposase -
  LT232_RS04215 (LT232_04215) - 849425..850180 (-) 756 WP_003154084.1 YoaK family protein -
  LT232_RS04220 (LT232_04220) nucA/comI 850240..850674 (-) 435 WP_015417516.1 NucA/NucB deoxyribonuclease domain-containing protein Machinery gene

Sequence

Protein


Download         Length: 144 a.a.        Molecular weight: 15514.44 Da        Isoelectric Point: 7.2418

>NTDB_id=636139 LT232_RS04220 WP_015417516.1 850240..850674(-) (nucA/comI) [Bacillus velezensis strain GSBZ09]
MNAFMKWAASLLLVISLQFGLTGAGIHSDSAARAASRYDQVLYFPLSKYPETGNHIKDAISAGHSEICTIDRGGAENRRK
ESLKGIPTKPGFDRDEWPMAVCTEGGAGADVRYVTPSDNRGAGSWVGNQMSGYSDGTRVLFIVQ

Nucleotide


Download         Length: 435 bp        

>NTDB_id=636139 LT232_RS04220 WP_015417516.1 850240..850674(-) (nucA/comI) [Bacillus velezensis strain GSBZ09]
ATGAATGCGTTTATGAAATGGGCGGCAAGTCTGCTTTTGGTGATCTCTCTTCAGTTCGGCCTTACGGGCGCCGGTATCCA
TTCGGACAGTGCTGCTCGTGCCGCATCCCGATACGATCAGGTGCTGTATTTCCCGCTGTCAAAATATCCGGAGACGGGAA
ATCATATAAAAGACGCCATTTCGGCAGGTCATTCTGAGATTTGTACAATTGATCGGGGCGGAGCAGAGAATAGAAGGAAA
GAATCATTGAAAGGAATTCCGACAAAGCCCGGGTTTGACCGTGATGAATGGCCCATGGCAGTCTGCACAGAAGGCGGGGC
GGGGGCTGATGTCAGATATGTAACCCCGTCGGATAACCGCGGGGCCGGTTCATGGGTTGGAAATCAAATGAGCGGATATT
CCGACGGCACGAGAGTATTATTTATCGTTCAGTAG

Domains

Predicted by InterproScan.

Deoxyribonuclease NucA/NucB (DNase_NucA_NucB)

(49-138)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  nucA/comI Bacillus subtilis subsp. subtilis str. 168

57.258

86.111

0.493