Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   N8A75_RS13260 Genome accession   NZ_CP104878
Coordinates   2437206..2437589 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   -
Organism   Bacillus subtilis strain 4ZT     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2432206..2442589
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N8A75_RS13220 (N8A75_13220) sinI 2433139..2433312 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N8A75_RS13225 (N8A75_13225) sinR 2433346..2433681 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N8A75_RS13230 (N8A75_13230) tasA 2433774..2434559 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  N8A75_RS13235 (N8A75_13235) sipW 2434623..2435195 (-) 573 WP_003230181.1 signal peptidase I SipW -
  N8A75_RS13240 (N8A75_13240) tapA 2435179..2435940 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  N8A75_RS13245 (N8A75_13245) yqzG 2436212..2436538 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N8A75_RS13250 (N8A75_13250) spoIITA 2436580..2436759 (-) 180 WP_029726723.1 YqzE family protein -
  N8A75_RS13255 (N8A75_13255) comGG 2436831..2437205 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  N8A75_RS13260 (N8A75_13260) comGF 2437206..2437589 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  N8A75_RS13265 (N8A75_13265) comGE 2437615..2437962 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  N8A75_RS13270 (N8A75_13270) comGD 2437946..2438377 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  N8A75_RS13275 (N8A75_13275) comGC 2438367..2438663 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  N8A75_RS13280 (N8A75_13280) comGB 2438677..2439714 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  N8A75_RS13285 (N8A75_13285) comGA 2439701..2440771 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  N8A75_RS13290 (N8A75_13290) - 2440983..2441180 (-) 198 WP_046160584.1 CBS domain-containing protein -
  N8A75_RS13295 (N8A75_13295) corA 2441182..2442135 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=634551 N8A75_RS13260 WP_046160582.1 2437206..2437589(-) (comGF) [Bacillus subtilis strain 4ZT]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=634551 N8A75_RS13260 WP_046160582.1 2437206..2437589(-) (comGF) [Bacillus subtilis strain 4ZT]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984