Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   N8A75_RS13220 Genome accession   NZ_CP104878
Coordinates   2433139..2433312 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain 4ZT     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2428139..2438312
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N8A75_RS13205 (N8A75_13205) gcvT 2428938..2430026 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  N8A75_RS13210 (N8A75_13210) hepAA 2430468..2432141 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  N8A75_RS13215 (N8A75_13215) yqhG 2432162..2432956 (+) 795 WP_014480249.1 YqhG family protein -
  N8A75_RS13220 (N8A75_13220) sinI 2433139..2433312 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N8A75_RS13225 (N8A75_13225) sinR 2433346..2433681 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N8A75_RS13230 (N8A75_13230) tasA 2433774..2434559 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  N8A75_RS13235 (N8A75_13235) sipW 2434623..2435195 (-) 573 WP_003230181.1 signal peptidase I SipW -
  N8A75_RS13240 (N8A75_13240) tapA 2435179..2435940 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  N8A75_RS13245 (N8A75_13245) yqzG 2436212..2436538 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N8A75_RS13250 (N8A75_13250) spoIITA 2436580..2436759 (-) 180 WP_029726723.1 YqzE family protein -
  N8A75_RS13255 (N8A75_13255) comGG 2436831..2437205 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  N8A75_RS13260 (N8A75_13260) comGF 2437206..2437589 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  N8A75_RS13265 (N8A75_13265) comGE 2437615..2437962 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=634548 N8A75_RS13220 WP_003230187.1 2433139..2433312(+) (sinI) [Bacillus subtilis strain 4ZT]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=634548 N8A75_RS13220 WP_003230187.1 2433139..2433312(+) (sinI) [Bacillus subtilis strain 4ZT]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1