Detailed information NTG0633638

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: KDJ21_RS13275
• Genome accession: NZ_CP088268
• Coordinates: 2719582..2719896 (+)
• Length: 104 a.a.
• NCBI ID: WP_212136679.1
• Uniprot ID: -
• Organism: Metabacillus litoralis strain NCTR108
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2714582..2724896

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KDJ21_RS13235 (KDJ21_013235)	-	2714772..2714945 (-)	174	WP_098799532.1	DUF2759 domain-containing protein	-
KDJ21_RS13240 (KDJ21_013240)	-	2715199..2715831 (+)	633	WP_121662828.1	MBL fold metallo-hydrolase	-
KDJ21_RS13245 (KDJ21_013245)	-	2715894..2716142 (-)	249	WP_098799530.1	DUF2626 domain-containing protein	-
KDJ21_RS13250 (KDJ21_013250)	-	2716482..2716862 (+)	381	WP_269671069.1	Spx/MgsR family RNA polymerase-binding regulatory protein	-
KDJ21_RS13260 (KDJ21_013260)	comGA	2717481..2718548 (+)	1068	WP_212136683.1	competence type IV pilus ATPase ComGA	Machinery gene
KDJ21_RS13265 (KDJ21_013265)	-	2718538..2719017 (+)	480	WP_232273269.1	type II secretion system F family protein	-
KDJ21_RS13270 (KDJ21_013270)	-	2719065..2719571 (+)	507	WP_269671070.1	type II secretion system F family protein	-
KDJ21_RS13275 (KDJ21_013275)	comGC	2719582..2719896 (+)	315	WP_212136679.1	competence type IV pilus major pilin ComGC	Machinery gene
KDJ21_RS13280 (KDJ21_013280)	comGD	2719871..2720326 (+)	456	WP_212136677.1	competence type IV pilus minor pilin ComGD	-
KDJ21_RS13285 (KDJ21_013285)	comGE	2720292..2720639 (+)	348	WP_212136675.1	competence type IV pilus minor pilin ComGE	-
KDJ21_RS13290 (KDJ21_013290)	comGF	2720560..2721066 (+)	507	WP_269671071.1	competence type IV pilus minor pilin ComGF	-
KDJ21_RS13295 (KDJ21_013295)	comGG	2721063..2721443 (+)	381	WP_212136673.1	competence type IV pilus minor pilin ComGG	-
KDJ21_RS13300 (KDJ21_013300)	-	2721485..2722000 (+)	516	WP_212136671.1	shikimate kinase	-
KDJ21_RS13305 (KDJ21_013305)	-	2722036..2722230 (+)	195	WP_212136669.1	YqzE family protein	-
KDJ21_RS13310 (KDJ21_013310)	-	2722365..2722679 (-)	315	WP_121662817.1	DUF3889 domain-containing protein	-
KDJ21_RS13315 (KDJ21_013315)	-	2722802..2723032 (+)	231	WP_212136667.1	hypothetical protein	-
KDJ21_RS13320 (KDJ21_013320)	-	2723029..2723631 (+)	603	WP_212136665.1	hypothetical protein	-
KDJ21_RS13325 (KDJ21_013325)	-	2723826..2723966 (-)	141	WP_121662814.1	anti-repressor SinI family protein	-
KDJ21_RS13330 (KDJ21_013330)	-	2723967..2724341 (-)	375	WP_121662813.1	XRE family transcriptional regulator	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 10988.83 Da
• Isoelectric Point: 6.4433

>NTDB_id=633638 KDJ21_RS13275 WP_212136679.1 2719582..2719896(+) (comGC) [Metabacillus litoralis strain NCTR108]
MKKEKGFTLIEMLIVLLVITVLLLITIPNVTKHNSSIQEKGCDGLINMVQAQVTSYQIDHKKIPTIGELQTGGYLRSTPV
CPNGNTVAIAADGVVSDGGAPAAD

Nucleotide

• Length: 315 bp

>NTDB_id=633638 KDJ21_RS13275 WP_212136679.1 2719582..2719896(+) (comGC) [Metabacillus litoralis strain NCTR108]
ATGAAGAAAGAAAAAGGTTTTACGTTAATTGAAATGCTAATTGTATTACTCGTTATAACGGTATTACTGCTTATTACGAT
TCCAAATGTTACGAAGCATAATAGCAGTATTCAAGAAAAAGGCTGTGATGGGCTTATTAATATGGTACAGGCTCAAGTAA
CATCTTATCAAATCGATCATAAAAAAATTCCTACAATAGGAGAACTACAAACCGGTGGCTATCTACGAAGTACACCTGTA
TGTCCAAATGGTAATACGGTTGCAATTGCTGCAGATGGAGTTGTTTCTGATGGAGGAGCACCAGCAGCCGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (1-26)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Bacillus subtilis subsp. subtilis str. 168	59.77	83.654	0.5