Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   LPC09_RS17360 Genome accession   NZ_CP088245
Coordinates   3409192..3409506 (-) Length   104 a.a.
NCBI ID   WP_231307890.1    Uniprot ID   -
Organism   Metabacillus sp. B2-18     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3404192..3414506
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LPC09_RS17315 (LPC09_17315) - 3404389..3405120 (-) 732 WP_098799163.1 Wzz/FepE/Etk N-terminal domain-containing protein -
  LPC09_RS17320 (LPC09_17320) - 3406056..3406268 (-) 213 WP_098799162.1 hypothetical protein -
  LPC09_RS17325 (LPC09_17325) - 3406395..3406709 (+) 315 WP_121662817.1 DUF3889 domain-containing protein -
  LPC09_RS17330 (LPC09_17330) - 3406859..3407053 (-) 195 WP_231307885.1 YqzE family protein -
  LPC09_RS17335 (LPC09_17335) - 3407106..3407603 (-) 498 WP_231307886.1 shikimate kinase -
  LPC09_RS17340 (LPC09_17340) comGG 3407645..3408025 (-) 381 WP_231307887.1 competence type IV pilus minor pilin ComGG -
  LPC09_RS17345 (LPC09_17345) comGF 3408022..3408525 (-) 504 WP_269217398.1 competence type IV pilus minor pilin ComGF -
  LPC09_RS17350 (LPC09_17350) comGE 3408449..3408796 (-) 348 WP_231307888.1 competence type IV pilus minor pilin ComGE -
  LPC09_RS17355 (LPC09_17355) comGD 3408762..3409217 (-) 456 WP_231307889.1 competence type IV pilus minor pilin ComGD -
  LPC09_RS17360 (LPC09_17360) comGC 3409192..3409506 (-) 315 WP_231307890.1 competence type IV pilus major pilin ComGC Machinery gene
  LPC09_RS17365 (LPC09_17365) comGB 3409517..3410551 (-) 1035 WP_231307891.1 competence type IV pilus assembly protein ComGB -
  LPC09_RS17370 (LPC09_17370) comGA 3410541..3411608 (-) 1068 WP_231307892.1 competence type IV pilus ATPase ComGA Machinery gene
  LPC09_RS17380 (LPC09_17380) - 3412292..3412672 (-) 381 WP_098799529.1 Spx/MgsR family RNA polymerase-binding regulatory protein -
  LPC09_RS17385 (LPC09_17385) - 3413015..3413263 (+) 249 WP_098799530.1 DUF2626 domain-containing protein -
  LPC09_RS17390 (LPC09_17390) - 3413328..3413960 (-) 633 WP_231307893.1 MBL fold metallo-hydrolase -
  LPC09_RS17395 (LPC09_17395) - 3414212..3414385 (+) 174 WP_098799532.1 DUF2759 domain-containing protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11015.86 Da        Isoelectric Point: 6.4433

>NTDB_id=633475 LPC09_RS17360 WP_231307890.1 3409192..3409506(-) (comGC) [Metabacillus sp. B2-18]
MKNEKGFTLIEMLIVLLVITVLLLITIPNVTKHNSSIQKKGCDGLINMVQAQVTSYQIDHKKIPTVGELETGGYLRNTPV
CPNGNTVVIAADGVVSDGGAPAAD

Nucleotide


Download         Length: 315 bp        

>NTDB_id=633475 LPC09_RS17360 WP_231307890.1 3409192..3409506(-) (comGC) [Metabacillus sp. B2-18]
ATGAAGAATGAAAAAGGATTTACGTTAATTGAAATGTTAATTGTATTACTCGTTATTACAGTATTGCTGCTTATTACGAT
TCCAAATGTCACGAAGCATAATAGCAGTATTCAAAAAAAAGGCTGTGATGGGCTTATTAATATGGTGCAGGCTCAAGTAA
CATCTTATCAAATTGATCATAAAAAAATACCTACAGTAGGAGAATTAGAAACAGGTGGTTATTTACGAAACACACCAGTA
TGTCCAAATGGAAATACGGTTGTAATTGCCGCAGATGGAGTGGTTTCTGATGGGGGAGCACCGGCTGCAGATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

60.227

84.615

0.51