Detailed information    

insolico Bioinformatically predicted

Overview

Name   treR   Type   Regulator
Locus tag   T15_RS01310 Genome accession   NC_022665
Coordinates   227941..228654 (-) Length   237 a.a.
NCBI ID   WP_012774930.1    Uniprot ID   A0A142UPI2
Organism   Streptococcus suis T15     
Function   regulate expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 175302..226985 227941..228654 flank 956


Gene organization within MGE regions


Location: 175302..228654
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  T15_RS01055 (T15_0179) - 175327..177594 (-) 2268 WP_023369163.1 Xaa-Pro dipeptidyl-peptidase -
  T15_RS01060 (T15_0180) - 177776..178510 (+) 735 WP_023369165.1 CppA N-terminal domain-containing protein -
  T15_RS01065 (T15_0181) - 178507..179448 (+) 942 WP_023369167.1 serine hydrolase domain-containing protein -
  T15_RS01070 (T15_0182) - 179445..179996 (+) 552 WP_023369169.1 DUF1697 domain-containing protein -
  T15_RS11780 - 180078..180221 (+) 144 WP_226315762.1 LysM peptidoglycan-binding domain-containing protein -
  T15_RS01075 - 180211..180870 (+) 660 WP_226315761.1 CHAP domain-containing protein -
  T15_RS01080 (T15_0185) pflB 181053..183398 (-) 2346 WP_023369171.1 formate C-acetyltransferase -
  T15_RS01085 (T15_0186) dinB 183714..184781 (+) 1068 WP_014637367.1 DNA polymerase IV -
  T15_RS01090 (T15_0187) - 184824..185243 (+) 420 WP_015646348.1 Rrf2 family transcriptional regulator -
  T15_RS01095 (T15_0188) - 185482..186108 (+) 627 WP_002935982.1 NAD(P)-dependent oxidoreductase -
  T15_RS01100 (T15_0189) - 186214..186534 (+) 321 WP_023369020.1 transposase -
  T15_RS01105 (T15_0190) - 186558..187418 (+) 861 WP_194717471.1 IS3 family transposase -
  T15_RS01110 (T15_0191) - 187523..188443 (+) 921 WP_011922588.1 1-phosphofructokinase family hexose kinase -
  T15_RS01115 (T15_0192) - 188491..189129 (+) 639 WP_014636205.1 endonuclease III domain-containing protein -
  T15_RS01125 (T15_0193) - 189412..190611 (-) 1200 WP_012774923.1 ROK family protein -
  T15_RS01130 (T15_0194) - 190804..192132 (+) 1329 WP_012774924.1 PTS sugar transporter subunit IIC -
  T15_RS01135 (T15_0195) - 192137..194023 (+) 1887 WP_012774925.1 DUF4838 domain-containing protein -
  T15_RS11785 - 194143..194379 (+) 237 WP_226315759.1 hypothetical protein -
  T15_RS01140 (T15_0196) - 194352..197858 (+) 3507 WP_023369175.1 right-handed parallel beta-helix repeat-containing protein -
  T15_RS01145 (T15_0197) - 197877..198638 (+) 762 WP_011921800.1 hypothetical protein -
  T15_RS01150 (T15_0198) - 198855..199619 (+) 765 WP_024384037.1 ABC transporter permease -
  T15_RS01155 (T15_0199) - 199604..200386 (+) 783 WP_012775424.1 ABC transporter ATP-binding protein -
  T15_RS01160 (T15_0200) - 200425..201456 (+) 1032 WP_011921803.1 ABC transporter substrate-binding protein -
  T15_RS01165 (T15_0201) - 201550..202359 (+) 810 WP_023369178.1 6-phosphogluconolactonase -
  T15_RS12050 - 202542..204611 (+) 2070 Protein_196 heavy metal translocating P-type ATPase -
  T15_RS01185 (T15_0205) - 204650..207139 (-) 2490 WP_012774926.1 ATP-dependent RecD-like DNA helicase -
  T15_RS01190 (T15_0206) - 207213..208073 (-) 861 WP_194717471.1 IS3 family transposase -
  T15_RS01195 (T15_0207) - 208097..208417 (-) 321 WP_023369020.1 transposase -
  T15_RS01200 (T15_0208) lepB 208646..209275 (-) 630 WP_011921809.1 signal peptidase I -
  T15_RS01205 (T15_0209) rnhC 209285..210175 (-) 891 WP_012774927.1 ribonuclease HIII -
  T15_RS01210 (T15_0210) - 210260..211243 (+) 984 WP_024384040.1 Gfo/Idh/MocA family protein -
  T15_RS01215 (T15_0211) - 211351..211671 (+) 321 WP_023369020.1 transposase -
  T15_RS01220 (T15_0212) - 211695..212555 (+) 861 WP_194717471.1 IS3 family transposase -
  T15_RS01225 (T15_0213) - 212610..213944 (-) 1335 WP_023369185.1 alanine/glycine:cation symporter family protein -
  T15_RS01230 (T15_0214) - 214368..215000 (-) 633 WP_023369187.1 ABC transporter ATP-binding protein -
  T15_RS12090 - 215002..215406 (-) 405 WP_228476902.1 DUF1430 domain-containing protein -
  T15_RS01235 - 215418..216833 (-) 1416 WP_228476903.1 hypothetical protein -
  T15_RS01240 (T15_0217) msrB 217075..218013 (-) 939 WP_023369189.1 peptide-methionine (R)-S-oxide reductase MsrB -
  T15_RS01245 (T15_0218) - 218053..219582 (-) 1530 WP_023369191.1 AMP-binding protein -
  T15_RS01250 (T15_0219) trxA 219715..220029 (-) 315 WP_012775426.1 thioredoxin -
  T15_RS01255 (T15_0220) - 220271..220591 (-) 321 WP_002935924.1 hypothetical protein -
  T15_RS01260 (T15_0221) - 220604..220990 (-) 387 WP_002935925.1 hypothetical protein -
  T15_RS01265 (T15_0222) - 220969..222198 (-) 1230 WP_023369193.1 Mbeg1-like protein -
  T15_RS01270 (T15_0223) - 222206..222583 (-) 378 WP_023369194.1 DUF1310 family protein -
  T15_RS01275 (T15_0224) - 222631..222978 (-) 348 WP_023369196.1 hypothetical protein -
  T15_RS01280 (T15_0225) - 222971..223360 (-) 390 WP_023369199.1 DUF1310 family protein -
  T15_RS01285 (T15_0226) - 223386..223649 (-) 264 WP_022540536.1 hypothetical protein -
  T15_RS01290 (T15_0227) - 223642..224034 (-) 393 WP_014636774.1 DUF1310 family protein -
  T15_RS01295 (T15_0228) - 224200..226533 (-) 2334 WP_023369201.1 endonuclease MutS2 -
  T15_RS01300 (T15_0229) - 227027..227575 (-) 549 WP_023369202.1 CvpA family protein -
  T15_RS01305 (T15_0230) - 227572..227883 (-) 312 WP_002935948.1 hypothetical protein -
  T15_RS01310 (T15_0231) treR 227941..228654 (-) 714 WP_012774930.1 trehalose operon repressor Regulator

Sequence

Protein


Download         Length: 237 a.a.        Molecular weight: 27200.07 Da        Isoelectric Point: 6.7422

>NTDB_id=63292 T15_RS01310 WP_012774930.1 227941..228654(-) (treR) [Streptococcus suis T15]
MKKYQEIYNDLKEKIRTNVYPAESSLPTEQQLQEIYGVSRDTVRKALAILTEGGLIQKVQGRGSMVLKQEILNFPVSGLT
SYQELTNVLQLSTKTDVVSLDMITVNSSLSHLTGFEPYSKVWKVVRTRSIDGKVSVVDTDYLAVDVVPELTTAIAEKSIY
EYLENKLGLDIAYAQKEITVEPTNREERELMQSKDDYLVLIKSRVYLGDTQQFQYTESKHKIDKFRFVDFARRKHSL

Nucleotide


Download         Length: 714 bp        

>NTDB_id=63292 T15_RS01310 WP_012774930.1 227941..228654(-) (treR) [Streptococcus suis T15]
ATGAAAAAATACCAAGAAATTTATAATGACTTAAAAGAAAAAATACGGACAAATGTTTATCCGGCAGAAAGCTCCCTACC
GACAGAACAGCAGCTTCAGGAAATCTATGGTGTTAGTCGTGATACGGTTCGTAAGGCGTTGGCGATTTTGACTGAGGGAG
GTTTGATTCAAAAAGTGCAAGGGCGTGGTTCAATGGTCCTTAAGCAAGAAATTCTCAATTTCCCAGTTTCAGGTTTAACT
TCCTATCAGGAATTGACAAATGTTCTCCAGCTTTCTACCAAGACAGATGTTGTCAGCTTAGATATGATTACCGTTAATAG
TAGCCTTTCGCATTTGACAGGCTTTGAGCCGTATAGCAAGGTGTGGAAAGTTGTCCGTACACGTTCGATTGACGGTAAGG
TCTCCGTTGTGGATACAGATTATCTTGCTGTCGATGTCGTGCCAGAGTTGACAACTGCTATTGCTGAAAAATCCATCTAC
GAATACCTAGAAAATAAGTTAGGCCTTGATATTGCTTATGCACAAAAAGAGATTACGGTAGAGCCGACCAATCGAGAAGA
GCGTGAGCTAATGCAATCGAAGGATGATTATTTGGTCTTGATTAAATCTCGTGTCTATCTCGGTGATACCCAACAATTCC
AATATACAGAAAGCAAGCATAAAATTGATAAATTCCGCTTTGTAGATTTTGCTCGTAGAAAGCATTCTTTATAG

Domains

Predicted by InterproScan.

Bacterial regulatory proteins, gntR family (GntR)

(3-66)

UTRA domain (UTRA)

(91-226)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A142UPI2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  treR Streptococcus mutans UA159

52.137

98.734

0.515

Multiple sequence alignment