Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | U471_RS11400 | Genome accession | NC_022653 |
| Coordinates | 2422913..2423086 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens CC178 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2417913..2428086
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| U471_RS11385 (U471_23680) | gcvT | 2418726..2419826 (-) | 1101 | WP_012117974.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| U471_RS11390 (U471_23690) | - | 2420250..2421920 (+) | 1671 | WP_012117975.1 | DEAD/DEAH box helicase | - |
| U471_RS11395 (U471_23700) | - | 2421942..2422736 (+) | 795 | WP_012117976.1 | YqhG family protein | - |
| U471_RS11400 (U471_23710) | sinI | 2422913..2423086 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| U471_RS11405 (U471_23720) | sinR | 2423120..2423455 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| U471_RS11410 (U471_23730) | tasA | 2423503..2424288 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| U471_RS11415 (U471_23740) | sipW | 2424353..2424937 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| U471_RS11420 (U471_23750) | tapA | 2424909..2425580 (-) | 672 | WP_012117978.1 | amyloid fiber anchoring/assembly protein TapA | - |
| U471_RS11425 (U471_23780) | - | 2425839..2426168 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| U471_RS11430 (U471_23790) | - | 2426208..2426387 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| U471_RS11435 (U471_23800) | comGG | 2426444..2426821 (-) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| U471_RS11440 (U471_23810) | comGF | 2426822..2427322 (-) | 501 | WP_012117981.1 | competence type IV pilus minor pilin ComGF | - |
| U471_RS11445 (U471_23820) | comGE | 2427231..2427545 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| U471_RS11450 (U471_23830) | comGD | 2427529..2427966 (-) | 438 | WP_012117983.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=63169 U471_RS11400 WP_003153105.1 2422913..2423086(+) (sinI) [Bacillus amyloliquefaciens CC178]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=63169 U471_RS11400 WP_003153105.1 2422913..2423086(+) (sinI) [Bacillus amyloliquefaciens CC178]
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |