Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LOK79_RS11805 Genome accession   NZ_CP087137
Coordinates   2445386..2445763 (-) Length   125 a.a.
NCBI ID   WP_015388005.1    Uniprot ID   -
Organism   Bacillus velezensis strain JIN4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2440386..2450763
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOK79_RS11765 (LOK79_11765) - 2440885..2441679 (+) 795 WP_014305407.1 YqhG family protein -
  LOK79_RS11770 (LOK79_11770) sinI 2441856..2442029 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LOK79_RS11775 (LOK79_11775) sinR 2442063..2442398 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LOK79_RS11780 (LOK79_11780) tasA 2442446..2443231 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  LOK79_RS11785 (LOK79_11785) sipW 2443295..2443879 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LOK79_RS11790 (LOK79_11790) tapA 2443851..2444522 (-) 672 WP_058906184.1 amyloid fiber anchoring/assembly protein TapA -
  LOK79_RS11795 (LOK79_11795) - 2444781..2445110 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LOK79_RS11800 (LOK79_11800) - 2445150..2445329 (-) 180 WP_003153093.1 YqzE family protein -
  LOK79_RS11805 (LOK79_11805) comGG 2445386..2445763 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  LOK79_RS11810 (LOK79_11810) comGF 2445764..2446159 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  LOK79_RS11815 (LOK79_11815) comGE 2446173..2446487 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  LOK79_RS11820 (LOK79_11820) comGD 2446471..2446908 (-) 438 WP_058906185.1 competence type IV pilus minor pilin ComGD Machinery gene
  LOK79_RS11825 (LOK79_11825) comGC 2446898..2447206 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LOK79_RS11830 (LOK79_11830) comGB 2447211..2448248 (-) 1038 WP_058906186.1 competence type IV pilus assembly protein ComGB Machinery gene
  LOK79_RS11835 (LOK79_11835) comGA 2448235..2449305 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LOK79_RS11840 (LOK79_11840) - 2449497..2450447 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14182.19 Da        Isoelectric Point: 9.9592

>NTDB_id=626867 LOK79_RS11805 WP_015388005.1 2445386..2445763(-) (comGG) [Bacillus velezensis strain JIN4]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGIQRFPYGTVS
FRITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=626867 LOK79_RS11805 WP_015388005.1 2445386..2445763(-) (comGG) [Bacillus velezensis strain JIN4]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTATACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504