Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BAPNAU_RS15780 Genome accession   NC_022530
Coordinates   3231761..3231901 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis NAU-B3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3226761..3236901
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAPNAU_RS15755 (BAPNAU_3053) - 3227100..3227483 (-) 384 WP_014418761.1 hotdog fold thioesterase -
  BAPNAU_RS15760 (BAPNAU_3054) comA 3227505..3228149 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  BAPNAU_RS15765 (BAPNAU_3055) comP 3228230..3230521 (-) 2292 WP_022553709.1 histidine kinase Regulator
  BAPNAU_RS15770 (BAPNAU_3056) comX 3230533..3230697 (-) 165 WP_007613432.1 competence pheromone ComX -
  BAPNAU_RS15775 (BAPNAU_3057) - 3230697..3231575 (-) 879 WP_032860494.1 polyprenyl synthetase family protein -
  BAPNAU_RS15780 (BAPNAU_3058) degQ 3231761..3231901 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BAPNAU_RS15785 (BAPNAU_3059) - 3232358..3232699 (+) 342 WP_014418765.1 hypothetical protein -
  BAPNAU_RS15790 (BAPNAU_3060) - 3232706..3233929 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  BAPNAU_RS15795 (BAPNAU_3061) - 3234059..3235525 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  BAPNAU_RS15800 (BAPNAU_3062) - 3235543..3236094 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  BAPNAU_RS15805 (BAPNAU_3063) - 3236191..3236589 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=62686 BAPNAU_RS15780 WP_003152043.1 3231761..3231901(-) (degQ) [Bacillus velezensis NAU-B3]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=62686 BAPNAU_RS15780 WP_003152043.1 3231761..3231901(-) (degQ) [Bacillus velezensis NAU-B3]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment