Detailed information    

insolico Bioinformatically predicted

Overview

Name   abrB   Type   Regulator
Locus tag   HQN46_RS20690 Genome accession   NZ_CP087103
Coordinates   4047817..4048095 (-) Length   92 a.a.
NCBI ID   WP_215712254.1    Uniprot ID   -
Organism   Bacillus toyonensis strain HA0190     
Function   repression of comK; repression of rok (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4008086..4055994 4047817..4048095 within 0


Gene organization within MGE regions


Location: 4008086..4055994
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HQN46_RS20425 (HQN46_0020425) - 4008086..4009768 (+) 1683 WP_001100043.1 DEAD/DEAH box helicase -
  HQN46_RS20430 (HQN46_0020430) - 4009755..4010549 (+) 795 WP_001183955.1 YqhG family protein -
  HQN46_RS29500 - 4010601..4010732 (-) 132 WP_000064664.1 hypothetical protein -
  HQN46_RS20435 (HQN46_0020435) - 4010830..4011057 (-) 228 WP_000032702.1 hypothetical protein -
  HQN46_RS20440 (HQN46_0020440) - 4011130..4011246 (+) 117 WP_073990725.1 GTP pyrophosphokinase -
  HQN46_RS20445 (HQN46_0020445) - 4011387..4012019 (+) 633 WP_001073099.1 VC0807 family protein -
  HQN46_RS20450 (HQN46_0020450) - 4012085..4012285 (-) 201 WP_000106086.1 YqzE family protein -
  HQN46_RS20455 (HQN46_0020455) - 4012324..4012821 (-) 498 WP_085450670.1 shikimate kinase -
  HQN46_RS20460 (HQN46_0020460) - 4012942..4013592 (-) 651 WP_139823524.1 2OG-Fe(II) oxygenase -
  HQN46_RS20465 (HQN46_0020465) comGG 4013767..4014138 (-) 372 WP_001231183.1 competence type IV pilus minor pilin ComGG -
  HQN46_RS20470 (HQN46_0020470) - 4014135..4014464 (-) 330 Protein_3992 competence type IV pilus minor pilin ComGF -
  HQN46_RS20475 (HQN46_0020475) - 4014847..4016112 (+) 1266 WP_097882749.1 Y-family DNA polymerase -
  HQN46_RS20480 (HQN46_0020480) - 4016109..4016450 (+) 342 WP_097882752.1 YolD-like family protein -
  HQN46_RS20485 (HQN46_0020485) - 4016515..4016847 (+) 333 WP_097882755.1 hypothetical protein -
  HQN46_RS20490 (HQN46_0020490) - 4017091..4018140 (+) 1050 WP_097882758.1 hypothetical protein -
  HQN46_RS20495 (HQN46_0020495) - 4018277..4019341 (-) 1065 WP_098188558.1 N-acetylmuramoyl-L-alanine amidase -
  HQN46_RS20500 (HQN46_0020500) - 4019338..4019577 (-) 240 WP_000461731.1 hypothetical protein -
  HQN46_RS20505 (HQN46_0020505) - 4019577..4019813 (-) 237 WP_000398742.1 hemolysin XhlA family protein -
  HQN46_RS20510 (HQN46_0020510) - 4019935..4020333 (-) 399 WP_098188559.1 hypothetical protein -
  HQN46_RS20515 (HQN46_0020515) - 4020348..4025804 (-) 5457 WP_215712236.1 phage tail spike protein -
  HQN46_RS20520 (HQN46_0020520) - 4025801..4027258 (-) 1458 WP_215712237.1 distal tail protein Dit -
  HQN46_RS20525 (HQN46_0020525) - 4027300..4029714 (-) 2415 WP_215712238.1 phage tail tape measure protein -
  HQN46_RS20530 (HQN46_0020530) - 4029972..4031180 (-) 1209 Protein_4004 DUF2207 domain-containing protein -
  HQN46_RS20535 (HQN46_0020535) - 4031412..4031774 (-) 363 WP_098163945.1 hypothetical protein -
  HQN46_RS20540 (HQN46_0020540) - 4031779..4032366 (-) 588 WP_215712240.1 major tail protein -
  HQN46_RS20545 (HQN46_0020545) - 4032367..4032696 (-) 330 WP_098163944.1 hypothetical protein -
  HQN46_RS20550 (HQN46_0020550) - 4032693..4033037 (-) 345 WP_215712241.1 HK97 gp10 family phage protein -
  HQN46_RS20555 (HQN46_0020555) - 4033039..4033392 (-) 354 WP_215712242.1 phage head closure protein -
  HQN46_RS20560 (HQN46_0020560) - 4033394..4033690 (-) 297 WP_098169564.1 hypothetical protein -
  HQN46_RS20565 (HQN46_0020565) - 4033703..4034866 (-) 1164 WP_098163524.1 phage major capsid protein -
  HQN46_RS20570 (HQN46_0020570) - 4034886..4035641 (-) 756 WP_098163525.1 head maturation protease, ClpP-related -
  HQN46_RS20575 (HQN46_0020575) - 4035622..4036788 (-) 1167 WP_215712243.1 phage portal protein -
  HQN46_RS20580 (HQN46_0020580) - 4036797..4038455 (-) 1659 WP_215712244.1 terminase TerL endonuclease subunit -
  HQN46_RS20585 (HQN46_0020585) - 4038452..4038787 (-) 336 WP_215712245.1 P27 family phage terminase small subunit -
  HQN46_RS20590 (HQN46_0020590) - 4038940..4039275 (-) 336 WP_215712246.1 HNH endonuclease -
  HQN46_RS20595 (HQN46_0020595) - 4039262..4039504 (-) 243 WP_215712247.1 hypothetical protein -
  HQN46_RS20600 (HQN46_0020600) - 4039495..4039824 (-) 330 WP_215712248.1 hypothetical protein -
  HQN46_RS20605 (HQN46_0020605) - 4039844..4040107 (-) 264 WP_215712249.1 hydrolase -
  HQN46_RS20610 (HQN46_0020610) - 4040131..4040391 (-) 261 WP_087949880.1 hypothetical protein -
  HQN46_RS20615 (HQN46_0020615) - 4040444..4040674 (-) 231 WP_087949881.1 YjcQ family protein -
  HQN46_RS20620 (HQN46_0020620) - 4041106..4042059 (-) 954 WP_215712250.1 nucleoside 2-deoxyribosyltransferase -
  HQN46_RS20625 (HQN46_0020625) - 4042255..4042797 (-) 543 WP_085451266.1 site-specific integrase -
  HQN46_RS20630 (HQN46_0020630) - 4042797..4043279 (-) 483 WP_000155189.1 ArpU family phage packaging/lysis transcriptional regulator -
  HQN46_RS20635 (HQN46_0020635) - 4043307..4043477 (-) 171 WP_081340397.1 hypothetical protein -
  HQN46_RS20640 (HQN46_0020640) - 4043580..4043771 (-) 192 WP_070189702.1 hypothetical protein -
  HQN46_RS20645 (HQN46_0020645) - 4043814..4043966 (-) 153 WP_176520128.1 hypothetical protein -
  HQN46_RS20650 (HQN46_0020650) - 4044380..4044601 (-) 222 WP_070189703.1 hypothetical protein -
  HQN46_RS20655 (HQN46_0020655) - 4045062..4045364 (-) 303 WP_016109003.1 hypothetical protein -
  HQN46_RS20660 (HQN46_0020660) - 4045539..4046060 (-) 522 WP_230075160.1 hypothetical protein -
  HQN46_RS20665 (HQN46_0020665) - 4046098..4046259 (-) 162 WP_230075161.1 hypothetical protein -
  HQN46_RS20670 (HQN46_0020670) - 4046298..4046753 (-) 456 WP_215712251.1 nucleoside triphosphate pyrophosphohydrolase family protein -
  HQN46_RS20675 (HQN46_0020675) - 4046780..4047253 (-) 474 WP_215712252.1 sugar ABC transporter substrate-binding protein -
  HQN46_RS20680 (HQN46_0020680) - 4047279..4047446 (-) 168 WP_000717826.1 DUF3954 domain-containing protein -
  HQN46_RS20685 (HQN46_0020685) - 4047465..4047824 (-) 360 WP_215712253.1 cell division protein SepF -
  HQN46_RS20690 (HQN46_0020690) abrB 4047817..4048095 (-) 279 WP_215712254.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Regulator
  HQN46_RS20695 (HQN46_0020695) - 4048112..4048306 (-) 195 WP_098923106.1 hypothetical protein -
  HQN46_RS20700 (HQN46_0020700) - 4048340..4049215 (-) 876 WP_215712255.1 ATP-binding protein -
  HQN46_RS20705 (HQN46_0020705) - 4049157..4050050 (-) 894 WP_215712256.1 conserved phage C-terminal domain-containing protein -
  HQN46_RS20710 (HQN46_0020710) - 4050055..4050231 (-) 177 WP_215712257.1 hypothetical protein -
  HQN46_RS20715 (HQN46_0020715) - 4050261..4050425 (-) 165 WP_097880563.1 hypothetical protein -
  HQN46_RS20720 (HQN46_0020720) - 4050438..4050698 (-) 261 WP_061529637.1 group-specific protein -
  HQN46_RS20725 (HQN46_0020725) - 4050711..4051370 (-) 660 WP_215712258.1 Rha family transcriptional regulator -
  HQN46_RS20730 (HQN46_0020730) - 4051348..4051611 (-) 264 WP_215712259.1 helix-turn-helix domain-containing protein -
  HQN46_RS20735 (HQN46_0020735) - 4051839..4052183 (+) 345 WP_097880557.1 helix-turn-helix domain-containing protein -
  HQN46_RS20740 (HQN46_0020740) - 4052449..4052601 (-) 153 WP_179862552.1 hypothetical protein -
  HQN46_RS20745 (HQN46_0020745) - 4052634..4053776 (-) 1143 WP_215712260.1 AimR family lysis-lysogeny pheromone receptor -
  HQN46_RS20750 (HQN46_0020750) - 4054273..4054626 (+) 354 WP_215712261.1 helix-turn-helix domain-containing protein -
  HQN46_RS20755 (HQN46_0020755) - 4054825..4055994 (+) 1170 WP_215712262.1 site-specific integrase -

Sequence

Protein


Download         Length: 92 a.a.        Molecular weight: 10225.86 Da        Isoelectric Point: 5.6565

>NTDB_id=626617 HQN46_RS20690 WP_215712254.1 4047817..4048095(-) (abrB) [Bacillus toyonensis strain HA0190]
MKNTGVARKVDELGRVVIPVELRRTLGIAEGTALDFHVDGENIVLRKHEKSCFVTGEVSELNLELLDGRMFLSKEGAIEL
LDILERSVKVHA

Nucleotide


Download         Length: 279 bp        

>NTDB_id=626617 HQN46_RS20690 WP_215712254.1 4047817..4048095(-) (abrB) [Bacillus toyonensis strain HA0190]
ATGAAAAACACAGGTGTTGCAAGAAAAGTGGACGAGCTAGGACGTGTAGTAATTCCAGTAGAGTTACGCAGAACTTTGGG
GATTGCTGAAGGTACAGCATTAGACTTTCATGTTGATGGGGAAAACATCGTTTTAAGAAAACATGAAAAGTCATGCTTTG
TAACGGGTGAAGTTTCCGAATTAAACTTGGAGTTACTAGATGGTCGAATGTTTTTGAGTAAGGAAGGCGCAATTGAGTTA
CTGGACATTCTTGAAAGAAGTGTGAAGGTACATGCCTAA

Domains

Predicted by InterproScan.

AbrB C-terminal domain (AbrB_C)

(52-85)

Antidote-toxin recognition MazE, bacterial antitoxin (MazE_antitoxin)

(8-49)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  abrB Bacillus subtilis subsp. subtilis str. 168

56.044

98.913

0.554