Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   N0B18_RS13045 Genome accession   NZ_CP103995
Coordinates   2418040..2418423 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM117109     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2413040..2423423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N0B18_RS13005 (N0B18_13005) sinI 2413974..2414147 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N0B18_RS13010 (N0B18_13010) sinR 2414181..2414516 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N0B18_RS13015 (N0B18_13015) tasA 2414609..2415394 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  N0B18_RS13020 (N0B18_13020) sipW 2415458..2416030 (-) 573 WP_003230181.1 signal peptidase I SipW -
  N0B18_RS13025 (N0B18_13025) tapA 2416014..2416775 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  N0B18_RS13030 (N0B18_13030) yqzG 2417047..2417373 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N0B18_RS13035 (N0B18_13035) spoIITA 2417415..2417594 (-) 180 WP_014480252.1 YqzE family protein -
  N0B18_RS13040 (N0B18_13040) comGG 2417665..2418039 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  N0B18_RS13045 (N0B18_13045) comGF 2418040..2418423 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  N0B18_RS13050 (N0B18_13050) comGE 2418449..2418796 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  N0B18_RS13055 (N0B18_13055) comGD 2418780..2419211 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  N0B18_RS13060 (N0B18_13060) comGC 2419201..2419497 (-) 297 WP_069964211.1 comG operon protein ComGC Machinery gene
  N0B18_RS13065 (N0B18_13065) comGB 2419511..2420548 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  N0B18_RS13070 (N0B18_13070) comGA 2420535..2421605 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  N0B18_RS13075 (N0B18_13075) - 2421817..2422014 (-) 198 WP_014480259.1 CBS domain-containing protein -
  N0B18_RS13080 (N0B18_13080) corA 2422016..2422969 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=626266 N0B18_RS13045 WP_014480254.1 2418040..2418423(-) (comGF) [Bacillus subtilis strain SRCM117109]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=626266 N0B18_RS13045 WP_014480254.1 2418040..2418423(-) (comGF) [Bacillus subtilis strain SRCM117109]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984