Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   FNP71_RS17365 Genome accession   NZ_AP019714
Coordinates   3251155..3251322 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   A8D470
Organism   Bacillus subtilis subsp. subtilis strain NBRC 13719     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3246155..3256322
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNP71_RS17335 (NBRC13719_32650) mrpE 3246550..3247026 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  FNP71_RS17340 (NBRC13719_32660) mrpF 3247026..3247310 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  FNP71_RS17345 (NBRC13719_32670) mnhG 3247294..3247668 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  FNP71_RS17350 (NBRC13719_32680) yuxO 3247707..3248087 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  FNP71_RS17355 (NBRC13719_32690) comA 3248106..3248750 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  FNP71_RS17360 comP 3248831..3251140 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  FNP71_RS17365 (NBRC13719_32720) comX 3251155..3251322 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  FNP71_RS17370 (NBRC13719_32730) comQ 3251310..3252209 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  FNP71_RS17375 (NBRC13719_32740) degQ 3252394..3252534 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  FNP71_RS17380 - 3252756..3252881 (+) 126 WP_003228793.1 hypothetical protein -
  FNP71_RS17385 (NBRC13719_32750) - 3252995..3253363 (+) 369 WP_003243784.1 hypothetical protein -
  FNP71_RS17390 (NBRC13719_32760) pdeH 3253339..3254568 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  FNP71_RS17395 (NBRC13719_32770) pncB 3254705..3256177 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=62403 FNP71_RS17365 WP_003242801.1 3251155..3251322(-) (comX) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=62403 FNP71_RS17365 WP_003242801.1 3251155..3251322(-) (comX) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A8D470

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment