Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LK685_RS08640 Genome accession   NZ_CP086061
Coordinates   1652359..1652532 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. BC1-43     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1647359..1657532
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LK685_RS08595 (LK685_08600) comGE 1647710..1648057 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  LK685_RS08600 (LK685_08605) comGF 1648083..1648466 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  LK685_RS08605 (LK685_08610) comGG 1648467..1648841 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  LK685_RS08610 (LK685_08615) - 1648912..1649091 (+) 180 WP_014480252.1 YqzE family protein -
  LK685_RS08615 (LK685_08620) - 1649133..1649459 (-) 327 WP_024573388.1 YqzG/YhdC family protein -
  LK685_RS08620 (LK685_08625) tapA 1649731..1650492 (+) 762 WP_229762707.1 amyloid fiber anchoring/assembly protein TapA -
  LK685_RS08625 (LK685_08630) - 1650476..1651048 (+) 573 WP_003246088.1 signal peptidase I -
  LK685_RS08630 (LK685_08635) tasA 1651112..1651897 (+) 786 WP_212058891.1 TasA family protein -
  LK685_RS08635 (LK685_08640) sinR 1651990..1652325 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LK685_RS08640 (LK685_08645) sinI 1652359..1652532 (-) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  LK685_RS08645 (LK685_08650) - 1652715..1653509 (-) 795 WP_003230200.1 YqhG family protein -
  LK685_RS08650 (LK685_08655) - 1653530..1655203 (-) 1674 WP_003230203.1 SNF2-related protein -
  LK685_RS08655 (LK685_08660) gcvT 1655645..1656733 (+) 1089 WP_229762708.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=622180 LK685_RS08640 WP_003230187.1 1652359..1652532(-) (sinI) [Bacillus sp. BC1-43]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=622180 LK685_RS08640 WP_003230187.1 1652359..1652532(-) (sinI) [Bacillus sp. BC1-43]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1