Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LJC78_RS16310 Genome accession   NZ_CP086007
Coordinates   3036713..3036853 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. natto strain SCP010-1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3031713..3041853
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJC78_RS16285 (LJC78_16285) yuxO 3031990..3032370 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  LJC78_RS16290 (LJC78_16290) comA 3032389..3033033 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  LJC78_RS16295 (LJC78_16295) comP 3033114..3035426 (-) 2313 WP_014480703.1 sensor histidine kinase Regulator
  LJC78_RS16300 (LJC78_16300) comX 3035442..3035663 (-) 222 WP_014480704.1 competence pheromone ComX -
  LJC78_RS16305 (LJC78_16305) - 3035665..3036528 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  LJC78_RS16310 (LJC78_16310) degQ 3036713..3036853 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LJC78_RS16315 (LJC78_16315) - 3037075..3037200 (+) 126 WP_003228793.1 hypothetical protein -
  LJC78_RS16320 (LJC78_16320) - 3037314..3037682 (+) 369 WP_014477834.1 hypothetical protein -
  LJC78_RS16325 (LJC78_16325) pdeH 3037658..3038887 (-) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  LJC78_RS16330 (LJC78_16330) pncB 3039023..3040495 (-) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  LJC78_RS16335 (LJC78_16335) pncA 3040511..3041062 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  LJC78_RS16340 (LJC78_16340) yueI 3041159..3041557 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=621995 LJC78_RS16310 WP_003220708.1 3036713..3036853(-) (degQ) [Bacillus subtilis subsp. natto strain SCP010-1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=621995 LJC78_RS16310 WP_003220708.1 3036713..3036853(-) (degQ) [Bacillus subtilis subsp. natto strain SCP010-1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1