Detailed information
Bioinformatically predicted
Overview
| Name | nucA/comI | Type | Machinery gene |
| Locus tag | LJC78_RS13345 | Genome accession | NZ_CP086007 |
| Coordinates | 2471646..2472056 (-) | Length | 136 a.a. |
| NCBI ID | WP_009967785.1 | Uniprot ID | A0A6I4D881 |
| Organism | Bacillus subtilis subsp. natto strain SCP010-1 | ||
| Function | cleavage of dsDNA into ssDNA (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2465434..2495971 | 2471646..2472056 | within | 0 |
| IS/Tn | 2470161..2471513 | 2471646..2472056 | flank | 133 |
Gene organization within MGE regions
Location: 2465434..2495971
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJC78_RS13315 (LJC78_13320) | yqeF | 2465601..2466332 (-) | 732 | WP_003229964.1 | SGNH/GDSL hydrolase family protein | - |
| LJC78_RS13320 (LJC78_13325) | cwlH | 2466584..2467336 (-) | 753 | WP_014480318.1 | N-acetylmuramoyl-L-alanine amidase CwlH | - |
| LJC78_RS13325 (LJC78_13330) | yqeD | 2467523..2468149 (+) | 627 | WP_014480319.1 | TVP38/TMEM64 family protein | - |
| LJC78_RS13330 (LJC78_13335) | gnd | 2468168..2469061 (-) | 894 | WP_014480320.1 | phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) | - |
| LJC78_RS13335 (LJC78_13340) | yqeB | 2469312..2470034 (+) | 723 | WP_014480321.1 | hypothetical protein | - |
| LJC78_RS13340 (LJC78_13345) | - | 2470161..2471513 (+) | 1353 | WP_014478984.1 | IS1182 family transposase | - |
| LJC78_RS13345 (LJC78_13350) | nucA/comI | 2471646..2472056 (-) | 411 | WP_009967785.1 | sporulation-specific Dnase NucB | Machinery gene |
| LJC78_RS13350 (LJC78_13355) | sigK | 2472252..2472980 (+) | 729 | WP_013308023.1 | RNA polymerase sporulation sigma factor SigK | - |
| LJC78_RS13355 (LJC78_13360) | - | 2472980..2473078 (+) | 99 | WP_031600702.1 | hypothetical protein | - |
| LJC78_RS13360 (LJC78_13365) | - | 2473075..2473287 (-) | 213 | Protein_2586 | recombinase family protein | - |
| LJC78_RS13365 (LJC78_13370) | fumC | 2473506..2474894 (-) | 1389 | WP_014480325.1 | class II fumarate hydratase | - |
| LJC78_RS13370 (LJC78_13375) | - | 2475061..2475951 (+) | 891 | WP_014480326.1 | LysR family transcriptional regulator | - |
| LJC78_RS13375 (LJC78_13380) | - | 2476893..2477288 (+) | 396 | WP_014480327.1 | VOC family protein | - |
| LJC78_RS13385 (LJC78_13390) | - | 2478028..2479155 (-) | 1128 | WP_014480328.1 | Rap family tetratricopeptide repeat protein | - |
| LJC78_RS22225 (LJC78_13395) | - | 2479337..2480170 (+) | 834 | Protein_2591 | ribonuclease YeeF family protein | - |
| LJC78_RS22230 (LJC78_13400) | - | 2480592..2481263 (+) | 672 | WP_228224803.1 | hypothetical protein | - |
| LJC78_RS13400 (LJC78_13405) | - | 2481277..2481564 (+) | 288 | WP_014480331.1 | hypothetical protein | - |
| LJC78_RS13405 (LJC78_13410) | - | 2481967..2482407 (+) | 441 | WP_014480332.1 | SMI1/KNR4 family protein | - |
| LJC78_RS13410 (LJC78_13415) | - | 2482506..2482958 (+) | 453 | WP_014480333.1 | SMI1/KNR4 family protein | - |
| LJC78_RS13415 (LJC78_13420) | cdiI | 2483055..2483414 (+) | 360 | WP_014480334.1 | ribonuclease toxin immunity protein CdiI | - |
| LJC78_RS13420 (LJC78_13425) | - | 2483519..2483998 (+) | 480 | WP_224588637.1 | hypothetical protein | - |
| LJC78_RS13425 (LJC78_13430) | - | 2484306..2484509 (-) | 204 | WP_123772462.1 | hypothetical protein | - |
| LJC78_RS13430 (LJC78_13435) | - | 2484598..2484831 (+) | 234 | WP_224588641.1 | hypothetical protein | - |
| LJC78_RS13435 (LJC78_13440) | atxG | 2485099..2485676 (+) | 578 | Protein_2600 | suppressor of fused domain protein | - |
| LJC78_RS13440 (LJC78_13445) | - | 2485786..2486076 (+) | 291 | WP_014480337.1 | contact-dependent growth inhibition system immunity protein | - |
| LJC78_RS13445 (LJC78_13450) | istA | 2486917..2488464 (+) | 1548 | WP_014480339.1 | IS21 family transposase | - |
| LJC78_RS13450 (LJC78_13455) | istB | 2488461..2489219 (+) | 759 | WP_014479891.1 | IS21-like element helper ATPase IstB | - |
| LJC78_RS22235 | - | 2489471..2489637 (-) | 167 | Protein_2604 | peptidoglycan-binding domain-containing protein | - |
| LJC78_RS13460 (LJC78_13465) | - | 2489812..2489898 (+) | 87 | WP_072592549.1 | putative holin-like toxin | - |
| LJC78_RS22240 (LJC78_13470) | - | 2490185..2490660 (-) | 476 | Protein_2606 | phage tail tube protein | - |
| LJC78_RS13475 (LJC78_13475) | terS | 2490620..2491184 (-) | 565 | Protein_2607 | phage terminase small subunit | - |
| LJC78_RS13480 (LJC78_13480) | - | 2491311..2491616 (+) | 306 | WP_123772463.1 | hypothetical protein | - |
| LJC78_RS13490 (LJC78_13490) | - | 2492009..2492488 (-) | 480 | WP_014480344.1 | hypothetical protein | - |
| LJC78_RS13495 (LJC78_13495) | - | 2493105..2493371 (+) | 267 | WP_033881358.1 | hypothetical protein | - |
| LJC78_RS13500 (LJC78_13500) | - | 2493510..2493662 (-) | 153 | WP_049832653.1 | XtrA/YqaO family protein | - |
| LJC78_RS13505 (LJC78_13505) | - | 2493745..2493867 (-) | 123 | Protein_2612 | RusA family crossover junction endodeoxyribonuclease | - |
| LJC78_RS13510 (LJC78_13510) | - | 2493830..2494078 (-) | 249 | Protein_2613 | hypothetical protein | - |
| LJC78_RS13515 (LJC78_13515) | - | 2494223..2494453 (-) | 231 | WP_224588644.1 | hypothetical protein | - |
| LJC78_RS13520 (LJC78_13520) | - | 2494762..2494942 (-) | 181 | Protein_2615 | hypothetical protein | - |
| LJC78_RS13525 (LJC78_13525) | bltR | 2495150..2495971 (-) | 822 | WP_014480349.1 | multidrug efflux transcriptional regulator BltR | - |
Sequence
Protein
Download Length: 136 a.a. Molecular weight: 14967.97 Da Isoelectric Point: 5.1853
>NTDB_id=621984 LJC78_RS13345 WP_009967785.1 2471646..2472056(-) (nucA/comI) [Bacillus subtilis subsp. natto strain SCP010-1]
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
MKKWMAGLFLAAAVLLCLMVPQQIQGASSYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPT
KPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Nucleotide
Download Length: 411 bp
>NTDB_id=621984 LJC78_RS13345 WP_009967785.1 2471646..2472056(-) (nucA/comI) [Bacillus subtilis subsp. natto strain SCP010-1]
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
ATGAAAAAATGGATGGCAGGCCTGTTTCTTGCTGCAGCAGTTCTTCTTTGTTTAATGGTTCCGCAACAGATCCAAGGCGC
ATCTTCGTATGACAAAGTGTTATATTTTCCGCTGTCTCGTTATCCGGAAACCGGCAGTCATATTAGAGATGCGATTGCAG
AGGGACATCCAGATATTTGTACCATTGACAGAGATGGAGCAGACAAAAGGCGGGAGGAATCTTTAAAGGGAATCCCGACC
AAGCCGGGCTATGACCGGGATGAGTGGCCGATGGCGGTCTGCGAGGAAGGCGGCGCAGGGGCTGATGTCCGATATGTGAC
GCCTTCTGATAATCGCGGCGCCGGCTCGTGGGTAGGGAATCAAATGAGCAGCTATCCTGACGGCACCAGAGTGCTGTTTA
TTGTGCAGTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| nucA/comI | Bacillus subtilis subsp. subtilis str. 168 |
62.609 |
84.559 |
0.529 |