Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | HQG80_RS11515 | Genome accession | NZ_CP085506 |
| Coordinates | 2230851..2231129 (+) | Length | 92 a.a. |
| NCBI ID | WP_098593299.1 | Uniprot ID | A0AB34D4R6 |
| Organism | Bacillus cereus strain HD2.4 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2205622..2273635 | 2230851..2231129 | within | 0 |
Gene organization within MGE regions
Location: 2205622..2273635
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HQG80_RS11360 (HQG80_011360) | - | 2205622..2206173 (+) | 552 | WP_000885397.1 | GNAT family N-acetyltransferase | - |
| HQG80_RS11365 (HQG80_011365) | - | 2206217..2206402 (-) | 186 | WP_000286203.1 | cold-shock protein | - |
| HQG80_RS11370 (HQG80_011370) | cspD | 2206489..2206692 (-) | 204 | WP_000176366.1 | cold-shock protein CspD | - |
| HQG80_RS11375 (HQG80_011375) | - | 2207076..2207972 (+) | 897 | WP_017657656.1 | CPBP family intramembrane glutamic endopeptidase | - |
| HQG80_RS11380 (HQG80_011380) | - | 2207972..2208631 (+) | 660 | WP_119683340.1 | AAA family ATPase | - |
| HQG80_RS11385 (HQG80_011385) | - | 2208889..2209494 (+) | 606 | WP_000846982.1 | PRK06770 family protein | - |
| HQG80_RS11390 (HQG80_011390) | - | 2209565..2210431 (-) | 867 | WP_017657658.1 | LysR family transcriptional regulator | - |
| HQG80_RS11395 (HQG80_011395) | - | 2210561..2211604 (+) | 1044 | WP_000591709.1 | aspartate-semialdehyde dehydrogenase | - |
| HQG80_RS11400 (HQG80_011400) | - | 2211683..2212114 (-) | 432 | WP_017657659.1 | hypothetical protein | - |
| HQG80_RS11405 (HQG80_011405) | - | 2212401..2213525 (+) | 1125 | WP_000285233.1 | C45 family peptidase | - |
| HQG80_RS11410 (HQG80_011410) | - | 2213577..2213840 (+) | 264 | WP_000921859.1 | hypothetical protein | - |
| HQG80_RS11415 (HQG80_011415) | - | 2213937..2214839 (-) | 903 | WP_000612237.1 | LysR substrate-binding domain-containing protein | - |
| HQG80_RS11420 (HQG80_011420) | - | 2214996..2215685 (+) | 690 | WP_001262993.1 | MOSC domain-containing protein | - |
| HQG80_RS11425 (HQG80_011425) | - | 2215944..2216831 (+) | 888 | WP_000528673.1 | GNAT family N-acetyltransferase | - |
| HQG80_RS11430 (HQG80_011430) | - | 2216865..2217461 (+) | 597 | WP_001027675.1 | DUF1349 domain-containing protein | - |
| HQG80_RS11435 (HQG80_011435) | - | 2217683..2219437 (+) | 1755 | WP_000834774.1 | ABC transporter ATP-binding protein | - |
| HQG80_RS11440 (HQG80_011440) | - | 2219430..2221226 (+) | 1797 | WP_173602729.1 | ABC transporter ATP-binding protein | - |
| HQG80_RS11445 (HQG80_011445) | exsF | 2221894..2222397 (-) | 504 | WP_001257871.1 | exosporium protein ExsF | - |
| HQG80_RS11450 (HQG80_011450) | - | 2222783..2223067 (-) | 285 | WP_001123247.1 | DUF4183 domain-containing protein | - |
| HQG80_RS11455 (HQG80_011455) | - | 2223459..2224565 (-) | 1107 | WP_173602712.1 | site-specific integrase | - |
| HQG80_RS11460 (HQG80_011460) | - | 2224991..2225344 (-) | 354 | WP_048558286.1 | helix-turn-helix transcriptional regulator | - |
| HQG80_RS11465 (HQG80_011465) | - | 2225843..2226985 (+) | 1143 | WP_173602713.1 | AimR family lysis-lysogeny pheromone receptor | - |
| HQG80_RS11470 (HQG80_011470) | - | 2227018..2227170 (+) | 153 | WP_173602714.1 | hypothetical protein | - |
| HQG80_RS29250 | - | 2227300..2227422 (+) | 123 | WP_255295443.1 | hypothetical protein | - |
| HQG80_RS11475 (HQG80_011475) | - | 2227436..2227780 (-) | 345 | WP_048558219.1 | helix-turn-helix transcriptional regulator | - |
| HQG80_RS11480 (HQG80_011480) | - | 2228004..2228243 (+) | 240 | WP_151639985.1 | helix-turn-helix transcriptional regulator | - |
| HQG80_RS11485 (HQG80_011485) | - | 2228327..2228593 (+) | 267 | WP_071730224.1 | helix-turn-helix domain-containing protein | - |
| HQG80_RS11490 (HQG80_011490) | - | 2228593..2228757 (+) | 165 | WP_098015098.1 | hypothetical protein | - |
| HQG80_RS11495 (HQG80_011495) | - | 2228787..2228963 (+) | 177 | WP_098593296.1 | hypothetical protein | - |
| HQG80_RS11500 (HQG80_011500) | - | 2228969..2229832 (+) | 864 | WP_098593297.1 | phage replisome organizer N-terminal domain-containing protein | - |
| HQG80_RS11505 (HQG80_011505) | - | 2229774..2230637 (+) | 864 | WP_098593298.1 | ATP-binding protein | - |
| HQG80_RS11510 (HQG80_011510) | - | 2230640..2230834 (+) | 195 | WP_098400102.1 | hypothetical protein | - |
| HQG80_RS11515 (HQG80_011515) | abrB | 2230851..2231129 (+) | 279 | WP_098593299.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| HQG80_RS11520 (HQG80_011520) | - | 2231122..2231481 (+) | 360 | WP_059303851.1 | hypothetical protein | - |
| HQG80_RS11525 (HQG80_011525) | - | 2231500..2231667 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| HQG80_RS11530 (HQG80_011530) | - | 2231693..2231944 (+) | 252 | WP_098400103.1 | helix-turn-helix domain containing protein | - |
| HQG80_RS11535 (HQG80_011535) | - | 2231965..2232180 (+) | 216 | WP_059303850.1 | hypothetical protein | - |
| HQG80_RS11540 (HQG80_011540) | - | 2232248..2232430 (+) | 183 | WP_173602715.1 | hypothetical protein | - |
| HQG80_RS11545 (HQG80_011545) | - | 2232427..2232963 (+) | 537 | WP_173602716.1 | dUTP diphosphatase | - |
| HQG80_RS11550 (HQG80_011550) | - | 2233006..2233218 (+) | 213 | WP_173602717.1 | hypothetical protein | - |
| HQG80_RS11555 (HQG80_011555) | - | 2233308..2233790 (+) | 483 | WP_227754005.1 | hypothetical protein | - |
| HQG80_RS11560 (HQG80_011560) | - | 2233804..2234079 (+) | 276 | WP_173602718.1 | hypothetical protein | - |
| HQG80_RS29360 | - | 2235554..2235802 (+) | 249 | WP_074602616.1 | helix-turn-helix transcriptional regulator | - |
| HQG80_RS11565 (HQG80_011565) | - | 2235820..2235963 (+) | 144 | WP_158236268.1 | hypothetical protein | - |
| HQG80_RS11570 (HQG80_011570) | - | 2236089..2237336 (+) | 1248 | WP_173602719.1 | hypothetical protein | - |
| HQG80_RS11575 (HQG80_011575) | - | 2237523..2237693 (+) | 171 | WP_059303843.1 | hypothetical protein | - |
| HQG80_RS11580 (HQG80_011580) | - | 2237717..2238190 (+) | 474 | WP_061684776.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| HQG80_RS11585 (HQG80_011585) | - | 2238187..2238729 (+) | 543 | WP_001055140.1 | tyrosine-type recombinase/integrase | - |
| HQG80_RS11590 (HQG80_011590) | - | 2239082..2239570 (+) | 489 | WP_139884049.1 | hypothetical protein | - |
| HQG80_RS11595 (HQG80_011595) | - | 2239967..2240713 (+) | 747 | WP_144640096.1 | site-specific DNA-methyltransferase | - |
| HQG80_RS11600 (HQG80_011600) | - | 2240744..2240959 (+) | 216 | WP_098593305.1 | hypothetical protein | - |
| HQG80_RS11605 (HQG80_011605) | - | 2240952..2241314 (+) | 363 | WP_173602728.1 | HNH endonuclease signature motif containing protein | - |
| HQG80_RS11610 (HQG80_011610) | - | 2241476..2241856 (+) | 381 | WP_076855602.1 | phage terminase small subunit P27 family | - |
| HQG80_RS11615 (HQG80_011615) | - | 2241837..2243609 (+) | 1773 | WP_173602720.1 | terminase large subunit | - |
| HQG80_RS11620 (HQG80_011620) | - | 2243625..2244839 (+) | 1215 | WP_078404576.1 | phage portal protein | - |
| HQG80_RS11625 (HQG80_011625) | - | 2244817..2245590 (+) | 774 | WP_173602721.1 | head maturation protease, ClpP-related | - |
| HQG80_RS11630 (HQG80_011630) | - | 2245587..2246774 (+) | 1188 | WP_086400929.1 | phage major capsid protein | - |
| HQG80_RS11635 (HQG80_011635) | - | 2246761..2247051 (+) | 291 | WP_173602722.1 | fibronectin type III domain-containing protein | - |
| HQG80_RS11640 (HQG80_011640) | - | 2247060..2247335 (+) | 276 | WP_086400931.1 | head-tail connector protein | - |
| HQG80_RS11645 (HQG80_011645) | - | 2247322..2247669 (+) | 348 | WP_173602723.1 | phage head closure protein | - |
| HQG80_RS11650 (HQG80_011650) | - | 2247657..2248094 (+) | 438 | WP_078404584.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| HQG80_RS11655 (HQG80_011655) | - | 2248091..2248450 (+) | 360 | WP_173602724.1 | structural protein | - |
| HQG80_RS11660 (HQG80_011660) | - | 2248463..2249050 (+) | 588 | WP_098593308.1 | major tail protein | - |
| HQG80_RS11665 (HQG80_011665) | - | 2249110..2249505 (+) | 396 | WP_086400936.1 | hypothetical protein | - |
| HQG80_RS11670 (HQG80_011670) | - | 2249523..2249663 (+) | 141 | WP_078404646.1 | LysR family transcriptional regulator | - |
| HQG80_RS11675 (HQG80_011675) | - | 2249679..2254694 (+) | 5016 | WP_173602725.1 | phage tail tape measure protein | - |
| HQG80_RS11680 (HQG80_011680) | - | 2254734..2256191 (+) | 1458 | WP_227754006.1 | distal tail protein Dit | - |
| HQG80_RS11685 (HQG80_011685) | - | 2256188..2261161 (+) | 4974 | WP_227754007.1 | phage tail spike protein | - |
| HQG80_RS11690 (HQG80_011690) | - | 2261173..2261553 (+) | 381 | WP_227754008.1 | hypothetical protein | - |
| HQG80_RS11695 (HQG80_011695) | - | 2261649..2261885 (+) | 237 | WP_000398738.1 | hemolysin XhlA family protein | - |
| HQG80_RS11700 (HQG80_011700) | - | 2261885..2262124 (+) | 240 | WP_173602734.1 | holin | - |
| HQG80_RS11705 (HQG80_011705) | - | 2262121..2263185 (+) | 1065 | WP_173602735.1 | N-acetylmuramoyl-L-alanine amidase | - |
| HQG80_RS11710 (HQG80_011710) | - | 2263801..2266602 (+) | 2802 | WP_173602736.1 | hypothetical protein | - |
| HQG80_RS11715 (HQG80_011715) | - | 2267048..2267284 (-) | 237 | WP_173603165.1 | hypothetical protein | - |
| HQG80_RS11720 (HQG80_011720) | - | 2267671..2268453 (-) | 783 | WP_000598280.1 | glycosyltransferase family 2 protein | - |
| HQG80_RS11725 (HQG80_011725) | - | 2268633..2269217 (-) | 585 | WP_001121273.1 | LysE family transporter | - |
| HQG80_RS11730 (HQG80_011730) | - | 2269273..2269887 (+) | 615 | WP_002197759.1 | helix-turn-helix domain-containing protein | - |
| HQG80_RS11735 (HQG80_011735) | - | 2270246..2270851 (-) | 606 | WP_000639404.1 | collagen-like triple helix repeat-containing protein | - |
| HQG80_RS11740 (HQG80_011740) | - | 2271068..2271781 (+) | 714 | WP_173602630.1 | DUF4183 domain-containing protein | - |
| HQG80_RS11745 (HQG80_011745) | - | 2272340..2273635 (+) | 1296 | WP_173602631.1 | exosporium glycoprotein BclB-related protein | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10135.75 Da Isoelectric Point: 6.7213
>NTDB_id=618676 HQG80_RS11515 WP_098593299.1 2230851..2231129(+) (abrB) [Bacillus cereus strain HD2.4]
MKKTGVSRKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGKVSESNIELLDGRMFLSKEGATEL
LDILEKSEMAHG
MKKTGVSRKVDELGRVVIPVELRRTLGIAEGTALGFHVEGENIVLRKHEKSCFVTGKVSESNIELLDGRMFLSKEGATEL
LDILEKSEMAHG
Nucleotide
Download Length: 279 bp
>NTDB_id=618676 HQG80_RS11515 WP_098593299.1 2230851..2231129(+) (abrB) [Bacillus cereus strain HD2.4]
ATGAAAAAAACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGAGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGTTTTG
TAACTGGCAAAGTTTCTGAATCAAACATTGAATTGCTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGAAATGGCACATGGCTAA
ATGAAAAAAACAGGTGTTTCAAGAAAAGTGGACGAGCTAGGGCGAGTGGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
AATTGCTGAAGGTACAGCATTAGGCTTTCATGTTGAAGGGGAAAACATTGTTTTAAGAAAACACGAAAAGTCATGTTTTG
TAACTGGCAAAGTTTCTGAATCAAACATTGAATTGCTGGATGGAAGAATGTTTCTAAGTAAAGAAGGAGCAACTGAATTA
CTGGACATTCTTGAAAAGAGTGAAATGGCACATGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
57.831 |
90.217 |
0.522 |