Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HQN37_RS14670 Genome accession   NZ_CP085505
Coordinates   3001190..3001330 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BT2.4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2996190..3006330
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HQN37_RS14645 (HQN37_014645) - 2996536..2996919 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  HQN37_RS14650 (HQN37_014650) comA 2996941..2997585 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  HQN37_RS14655 (HQN37_014655) comP 2997666..2999966 (-) 2301 WP_012118313.1 histidine kinase Regulator
  HQN37_RS14660 (HQN37_014660) comX 2999980..3000153 (-) 174 WP_012118314.1 competence pheromone ComX -
  HQN37_RS14665 (HQN37_014665) - 3000122..3000982 (-) 861 WP_012118315.1 polyprenyl synthetase family protein -
  HQN37_RS14670 (HQN37_014670) degQ 3001190..3001330 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HQN37_RS14675 (HQN37_014675) - 3001795..3002136 (+) 342 WP_012118316.1 hypothetical protein -
  HQN37_RS14680 (HQN37_014680) - 3002143..3003366 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  HQN37_RS14685 (HQN37_014685) - 3003496..3004962 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  HQN37_RS14690 (HQN37_014690) - 3004980..3005531 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  HQN37_RS14695 (HQN37_014695) - 3005628..3006026 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=618638 HQN37_RS14670 WP_003152043.1 3001190..3001330(-) (degQ) [Bacillus velezensis strain BT2.4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=618638 HQN37_RS14670 WP_003152043.1 3001190..3001330(-) (degQ) [Bacillus velezensis strain BT2.4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891