Detailed information
Bioinformatically predicted
Overview
| Name | abrB | Type | Regulator |
| Locus tag | FHQ13_RS26870 | Genome accession | NZ_CP085501 |
| Coordinates | 5256574..5256852 (+) | Length | 92 a.a. |
| NCBI ID | WP_139849675.1 | Uniprot ID | - |
| Organism | Bacillus cereus strain A24 | ||
| Function | repression of comK; repression of rok (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 5244938..5268017 | 5256574..5256852 | within | 0 |
Gene organization within MGE regions
Location: 5244938..5268017
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FHQ13_RS26775 (FHQ13_026775) | tenA | 5244938..5245627 (+) | 690 | WP_139849670.1 | thiaminase II | - |
| FHQ13_RS26780 (FHQ13_026780) | - | 5246026..5246289 (+) | 264 | WP_016122577.1 | DUF3937 family protein | - |
| FHQ13_RS26785 (FHQ13_026785) | - | 5246843..5247163 (+) | 321 | WP_001071364.1 | heterocycloanthracin/sonorensin family bacteriocin | - |
| FHQ13_RS26790 (FHQ13_026790) | - | 5247343..5247443 (+) | 101 | Protein_5224 | site-specific integrase | - |
| FHQ13_RS26795 (FHQ13_026795) | - | 5247653..5248138 (+) | 486 | WP_025687515.1 | hypothetical protein | - |
| FHQ13_RS26800 (FHQ13_026800) | - | 5248450..5249121 (+) | 672 | WP_139849671.1 | DUF3962 domain-containing protein | - |
| FHQ13_RS26805 (FHQ13_026805) | - | 5249190..5250299 (-) | 1110 | WP_139849672.1 | tyrosine-type recombinase/integrase | - |
| FHQ13_RS26810 (FHQ13_026810) | - | 5250964..5252172 (+) | 1209 | WP_139849673.1 | AimR family lysis-lysogeny pheromone receptor | - |
| FHQ13_RS26815 (FHQ13_026815) | - | 5252199..5252354 (+) | 156 | WP_000791664.1 | hypothetical protein | - |
| FHQ13_RS26820 (FHQ13_026820) | - | 5252615..5252965 (-) | 351 | WP_130813783.1 | helix-turn-helix transcriptional regulator | - |
| FHQ13_RS26825 (FHQ13_026825) | - | 5253149..5253445 (+) | 297 | WP_130813784.1 | helix-turn-helix transcriptional regulator | - |
| FHQ13_RS29320 | - | 5253540..5253602 (+) | 63 | Protein_5232 | hypothetical protein | - |
| FHQ13_RS26835 (FHQ13_026835) | - | 5253661..5253927 (+) | 267 | WP_000522024.1 | helix-turn-helix domain-containing protein | - |
| FHQ13_RS26840 (FHQ13_026840) | - | 5253927..5254091 (+) | 165 | WP_000390298.1 | hypothetical protein | - |
| FHQ13_RS26845 (FHQ13_026845) | - | 5254121..5254297 (+) | 177 | WP_180352137.1 | hypothetical protein | - |
| FHQ13_RS26850 (FHQ13_026850) | - | 5254302..5255051 (+) | 750 | WP_139849674.1 | DnaD domain protein | - |
| FHQ13_RS26855 (FHQ13_026855) | - | 5255020..5255823 (+) | 804 | WP_130813803.1 | ATP-binding protein | - |
| FHQ13_RS26860 (FHQ13_026860) | - | 5255838..5255999 (+) | 162 | WP_180352139.1 | hypothetical protein | - |
| FHQ13_RS26865 (FHQ13_026865) | - | 5256361..5256555 (+) | 195 | Protein_5239 | hypothetical protein | - |
| FHQ13_RS26870 (FHQ13_026870) | abrB | 5256574..5256852 (+) | 279 | WP_139849675.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Regulator |
| FHQ13_RS26875 (FHQ13_026875) | - | 5256845..5257204 (+) | 360 | WP_139849676.1 | cell division protein SepF | - |
| FHQ13_RS26880 (FHQ13_026880) | - | 5257223..5257390 (+) | 168 | WP_000717825.1 | DUF3954 domain-containing protein | - |
| FHQ13_RS26885 (FHQ13_026885) | - | 5257470..5257667 (+) | 198 | WP_227749004.1 | helix-turn-helix domain containing protein | - |
| FHQ13_RS26890 (FHQ13_026890) | - | 5257687..5258169 (+) | 483 | WP_139849677.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| FHQ13_RS26895 (FHQ13_026895) | - | 5258310..5259446 (-) | 1137 | WP_139849678.1 | hypothetical protein | - |
| FHQ13_RS26900 (FHQ13_026900) | - | 5259866..5260348 (+) | 483 | WP_106824978.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FHQ13_RS26905 (FHQ13_026905) | - | 5260348..5260890 (+) | 543 | WP_139849679.1 | site-specific integrase | - |
| FHQ13_RS26910 (FHQ13_026910) | - | 5261088..5261648 (-) | 561 | WP_139847865.1 | TetR/AcrR family transcriptional regulator | - |
| FHQ13_RS26915 (FHQ13_026915) | - | 5261999..5264206 (+) | 2208 | WP_180352141.1 | MMPL family transporter | - |
| FHQ13_RS26920 (FHQ13_026920) | - | 5264567..5265244 (+) | 678 | WP_050843742.1 | hypothetical protein | - |
| FHQ13_RS26925 (FHQ13_026925) | - | 5265631..5265864 (+) | 234 | WP_139849680.1 | hypothetical protein | - |
| FHQ13_RS26930 (FHQ13_026930) | - | 5265861..5266241 (-) | 381 | WP_098399190.1 | DUF2513 domain-containing protein | - |
| FHQ13_RS26935 (FHQ13_026935) | - | 5266383..5266541 (+) | 159 | WP_180352133.1 | hypothetical protein | - |
| FHQ13_RS26940 (FHQ13_026940) | - | 5266538..5266744 (+) | 207 | WP_098256765.1 | hypothetical protein | - |
| FHQ13_RS26945 (FHQ13_026945) | - | 5266763..5267017 (+) | 255 | WP_063224946.1 | hypothetical protein | - |
| FHQ13_RS26950 (FHQ13_026950) | - | 5267007..5267384 (+) | 378 | WP_139849681.1 | HNH endonuclease | - |
| FHQ13_RS26955 (FHQ13_026955) | - | 5267514..5268017 (+) | 504 | WP_000251640.1 | phage terminase small subunit P27 family | - |
Sequence
Protein
Download Length: 92 a.a. Molecular weight: 10171.78 Da Isoelectric Point: 5.1487
>NTDB_id=618504 FHQ13_RS26870 WP_139849675.1 5256574..5256852(+) (abrB) [Bacillus cereus strain A24]
MKNTGVARKVDELGRIVIPVELRRTLGIVEGTTLDFHIEGENIVLRKYENSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
MKNTGVARKVDELGRIVIPVELRRTLGIVEGTTLDFHIEGENIVLRKYENSCFVTGEVSETNIELLGGRMFLSKEGAIEL
LDLIQKSGMAHA
Nucleotide
Download Length: 279 bp
>NTDB_id=618504 FHQ13_RS26870 WP_139849675.1 5256574..5256852(+) (abrB) [Bacillus cereus strain A24]
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTATAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGACACTAGATTTTCATATCGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAACTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGAGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
ATGAAAAACACAGGCGTTGCAAGAAAAGTGGACGAGCTAGGTCGTATAGTAATTCCAGTAGAGTTACGCAGAACTTTAGG
GATTGTCGAAGGAACGACACTAGATTTTCATATCGAGGGTGAAAACATTGTTCTAAGAAAATATGAAAACTCATGCTTTG
TAACGGGTGAAGTTTCTGAAACCAACATAGAGTTGCTAGGTGGCCGAATGTTTTTAAGCAAGGAAGGAGCAATTGAATTA
CTGGATCTTATTCAGAAGAGTGGGATGGCACATGCCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| abrB | Bacillus subtilis subsp. subtilis str. 168 |
56.322 |
94.565 |
0.533 |